Dataset for protein E1B 19K of organism Human adenovirus 11

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q7T8D8_E1B19K-02      MDPADSFQQGIRFGFHSHSIVENMEGSQDEDNLRLLASAAFGCSGNPEAS
Q7T8D8_E1B19K-03      -----------------------------------MSGNASFKGG-----
Q7T8D8_E1B19K-01      --------------MEVWAILEDLRKTR-----QLLENASDGVSG-----
Q8B8U7_E1B19K-01      --------------MEVWAILEDLRKTR-----QLLENASDGVSG-----
                                                         : . :   .*     

Q7T8D8_E1B19K-02      TGHASGSGGGTARGQPESRPGPSSGGGGVADLSPELQRVLTGSTSTGRDR
Q7T8D8_E1B19K-03      --------------------------------------------------
Q7T8D8_E1B19K-01      --------------------------------------------------
Q8B8U7_E1B19K-01      --------------------------------------------------
                                                                        

Q7T8D8_E1B19K-02      GVKRERASSGTDARSELALSLMSRRRPETIWWHEVQKEGRDEVSVLQEKY
Q7T8D8_E1B19K-03      --------------------------------------------------
Q7T8D8_E1B19K-01      --------------------------------------------------
Q8B8U7_E1B19K-01      --------------------------------------------------
                                                                        

Q7T8D8_E1B19K-02      SLEQVKTCWLEPEDDWEVAIKNYAKIALRPDKQYKITRRINIRNACYISG
Q7T8D8_E1B19K-03      ----VFSPYLTGR---------LPSWA-----GVR---------------
Q7T8D8_E1B19K-01      ----FWRFWFASE---------LARVVFRIKQDYK---------------
Q8B8U7_E1B19K-01      ----FWRFWFASE---------LARVVFRIKQDYN---------------
                          .   ::             .  .       .               

Q7T8D8_E1B19K-02      NGAEVVIDTQDKAVIRCCMMDMWPGVVGMEAVTFVNVKFRGDGYNGIVFM
Q7T8D8_E1B19K-03      -------------------------------------------------Q
Q7T8D8_E1B19K-01      -------------------------------------------------Q
Q8B8U7_E1B19K-01      -------------------------------------------------Q
                                                                        

Q7T8D8_E1B19K-02      ANTKLILHGCSFFGFNNTCVDAWGQVSVRGCSFYACWIATAGRTKSQLSL
Q7T8D8_E1B19K-03      NVMGSTVDGRPVQ----PA---------NSSTLTYATLSSSPLDAAAAAA
Q7T8D8_E1B19K-01      EFEKLLVDCPGLF----EALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAF
Q8B8U7_E1B19K-01      EFEKLLVDCPGLF----EALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAF
                            :    .      .         .   :    :::.    :  : 

Q7T8D8_E1B19K-02      KKCIFQRCNLGILNEGEARVRHCASTDTGCFILIKGNASVKHNMICGASD
Q7T8D8_E1B19K-03      AASVAANTVLGM--------------------------------------
Q7T8D8_E1B19K-01      LTFILDKWIPQT--------------------------------------
Q8B8U7_E1B19K-01      LTFILDKWIPQT--------------------------------------
                         :  .                                           

Q7T8D8_E1B19K-02      ERPYQMLTCAGGHCNMLATVHIVSHQRKKWPVFDHNVMTKCTMHAGGRRG
Q7T8D8_E1B19K-03      -----------GYYGSIMANSTSSNNPSTL--------------------
Q7T8D8_E1B19K-01      -----------HFSRGYVLDFIATALWRTW--------------------
Q8B8U7_E1B19K-01      -----------HFSRGYVLDFIATALWRTW--------------------
                                  .          :    .                     

Q7T8D8_E1B19K-02      MFMPYQCNMNHVKVLLEPDAFSRMSLTGIFDMNMQIWKILRYDDTRSRVR
Q7T8D8_E1B19K-03      -------TQDKLLVLLA---------------------------------
Q7T8D8_E1B19K-01      -------KVRKMRTILGYWPVQPLGVAGIL--------------------
Q8B8U7_E1B19K-01      -------KVRKMRTILGYWPVQPLGVAGIL--------------------
                             .  :: .:*                                  

Q7T8D8_E1B19K-02      ACECGGKHARFQPVCVDVTEDLRPDHLVIARTGAEFGSSGEETD
Q7T8D8_E1B19K-03      ---------QLEALTQRLGEL--SQQVVELRVQTESAVGTAKSK
Q7T8D8_E1B19K-01      ---------RHPPVMPAVLEE--EQQEDNPRAGLDPPVEEAE--
Q8B8U7_E1B19K-01      ---------RHPPVMPAVLEE--EQQEDNPRAGLDPPVEEAE--
                               .  .:   : *    ::    *.  :      :  

© 1998-2021Legal notice