Dataset for protein E1B 19K of organism Human adenovirus 11

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q8B8U7_E1B19K-01 E1B19K protein OS=[Viruses] Human adenovirus 11 GN=E1B19K (length=180 residues).
MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASELARVVFRIKQDYNQEFEKLLVDCPGLFEALNLGHQVHFKEKVLSV
LDFSTPGRTAAAVAFLTFILDKWIPQTHFSRGYVLDFIATALWRTWKVRKMRTILGYWPVQPLGVAGILRHPPVMPAVLE
EEQQEDNPRAGLDPPVEEAE
© 1998-2022Legal notice