Dataset for protein BCL-2-like of organism Vulpes vulpes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                      .  .                                      
---------------------------asspdtralvadfvgyklr-----qkgyv-g---g------------------
mfglkrnaviglnlycggaglgdmatp--a------mvgslavtrsegggger---c-agp-asppttlapdarrvarps
                       rsgg m-ssn l as kestrcg     aa a i gsa                   
                              qgg e                                             

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------egpaad-------------------------------------------
pigaegpnvsatpprllllappcrasppeem------plmspeeeldgyepeplgkrpavlpllelvgeassgpgmdgsl
                                     ai                                         
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                      :         
-----------------------------------------------------r--gd--------tfsdlaaqlhvtpg
pstpppaeeeedelyrqsleiisrylreqatgakdakplggsraasrkahqam-aa--efetrfrr----ftrvetnvte
                                                 letl rv  gvqrnhetswqqmsdk eirss
                                                                  a  g lch ddkn 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      :            .*         ..                                                
saqqsfsqvsdelfqgg-pnWgrlvalfvfga-----------e-------e-----l-trlsdwlhssrgweleaikar
dpvtrqtrsevpvasrrvts pli--fasnsgalcaesvnkem-plvgqvq-wmvay-ertpavsivrrgvip-------
anlktl emiths in sed hfadtpila  fvakhlksinq sciepla sitdv vqskrsiyskqeledma v qa
 deg e a  rai ad n       s                                  gh    dai           

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                    . *::   .  :.        :  *   
vremeeeae-klkelqnevekqmnmspppgnagpvimsieekmeadarsiyvgnVdygataeeleahfhgcgsvnrVtil
---------l------------------------------------------dg nw-rivaffs------lgirs lle
l  agd f  ryrrafsdlts lhit gtay         qsf qvvnelfr f ef fh  d     g a c en dka
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   . .   .                                                                      
cdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrgfpraryrarttnynssrsrfysgf
mqvvvsviaawmat------------------------------------------------------------------
fagla rg  l  lyln    i                hle wiqeng wd                         vely
                                                                                

       490       500       510        
....:....|....:....|....:....|....:...
                                      
nsrprgrvyrgraratswyspy----------------
----------------------mtvagvvllgslfsrk
gnnaaaesrk qe fnr fltg                
                                      
© 1998-2020Legal notice