Dataset for protein BCL-2-like of organism Vulpes vulpes

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A3Q7QZT9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Vulpes vulpes GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGDRSGGASSSGGRLLASGKEATTRREGGGGEAGAVIGGSAGASPPTTLAPDARRVARPS
PIGAEGPNVSATPPRLLLLAPPCRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGMDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLGGSRAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A3Q7R8S3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Vulpes vulpes GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A3Q7T511_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Vulpes vulpes GN=BCL2L2 (length=254 residues).
MAGSLAVRCGARFTCHETDVSSSNLTSQSASERAIAARRSEDWPFLLALASGQSPSVIYSRIRLEELEAIKARVREMEEE
AEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHP
KGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRV
YRGRARATSWYSPY
>gnl|bcl2dbpro|A0A3Q7T511_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Vulpes vulpes GN=BCL2L2 (length=333 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RGRARATSWYSPY
>gnl|bcl2dbpro|A0A3Q7T511_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Vulpes vulpes GN=BCL2L2 (length=333 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RGRARATSWYSPY
© 1998-2020Legal notice