Dataset for protein BCL-2-like of organism Vulpes vulpes

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q7QZT9_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGDRSGGASSSGGRLLASGKEATTRREGGG
A0A3Q7T511_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLR----
A0A3Q7T511_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLR----
A0A3Q7R8S3_BCL2L1-      ----------------------------MSQSNRELVVDFLSYKLS----
A0A3Q7T511_BCL2L2-      ------------------------------------MAGSLAVRCG----
                                                              .  .        

A0A3Q7QZT9_MCL1-01      GEAGAVIGGSAGASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLA
A0A3Q7T511_BCL2L2-      -QKGYVCGAGPG--------------------------------------
A0A3Q7T511_BCL2L2-      -QKGYVCGAGPG--------------------------------------
A0A3Q7R8S3_BCL2L1-      -QKGY---------------------------------------------
A0A3Q7T511_BCL2L2-      -AR-----------------------------------------------
                                                                          

A0A3Q7QZT9_MCL1-01      PPCRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
A0A3Q7T511_BCL2L2-      -----------EGPAADPL-------------------------------
A0A3Q7T511_BCL2L2-      -----------EGPAADPL-------------------------------
A0A3Q7R8S3_BCL2L1-      --------------------------------------------------
A0A3Q7T511_BCL2L2-      --------------------------------------------------
                                                                          

A0A3Q7QZT9_MCL1-01      SSGPGMDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLG
A0A3Q7T511_BCL2L2-      --------------------------------------------------
A0A3Q7T511_BCL2L2-      --------------------------------------------------
A0A3Q7R8S3_BCL2L1-      --------------------------------------------------
A0A3Q7T511_BCL2L2-      --------------------------------------------------
                                                                          

A0A3Q7QZT9_MCL1-01      GSRAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVI
A0A3Q7T511_BCL2L2-      ---------HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVS
A0A3Q7T511_BCL2L2-      ---------HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVS
A0A3Q7R8S3_BCL2L1-      --------------------------SWSQFSDVEENRTEAPEGTESEME
A0A3Q7T511_BCL2L2-      ------------------------------FTCHETDVSSSNLTSQSASE
                                                      :               :   

A0A3Q7QZT9_MCL1-01      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
A0A3Q7T511_BCL2L2-      DELFQGG-PNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLET
A0A3Q7T511_BCL2L2-      DELFQGG-PNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLET
A0A3Q7R8S3_BCL2L1-      TPSAINGNPSWHLADSPAVNGA---------------------------T
A0A3Q7T511_BCL2L2-      RAIAARRSEDWPFL--LALASG---------------------------Q
                                 .*         ..                            

A0A3Q7QZT9_MCL1-01      TKRDWLVKQRGWD-------------------------------------
A0A3Q7T511_BCL2L2-      RLADWIHSSGGWELEAIKARVREMEEEAE-KLKELQNEVEKQMNMSPPPG
A0A3Q7T511_BCL2L2-      RLADWIHSSGGWELEAIKARVREMEEEAE-KLKELQNEVEKQMNMSPPPG
A0A3Q7R8S3_BCL2L1-      GHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTA
A0A3Q7T511_BCL2L2-      SPSVIYSRIRLEELEAIKARVREMEEEAE-KLKELQNEVEKQMNMSPPPG
                                                                          

A0A3Q7QZT9_MCL1-01      ----------------------GFVEF-FHVEDLE------GGIRNVLLA
A0A3Q7T511_BCL2L2-      NAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTIL
A0A3Q7T511_BCL2L2-      NAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTIL
A0A3Q7R8S3_BCL2L1-      Y---------QSFEQVVNELFRDGVNWGRIVAFFS--FGGALCVESVDKE
A0A3Q7T511_BCL2L2-      NAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTIL
                                              . *::   .  :.        :  *   

A0A3Q7QZT9_MCL1-01      FAGVAGVGAGLAYL-------IR---------------------------
A0A3Q7T511_BCL2L2-      CDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGI
A0A3Q7T511_BCL2L2-      CDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGI
A0A3Q7R8S3_BCL2L1-      MQVLVSRIAAWMATYLND--------------------HLEPWIQENGGW
A0A3Q7T511_BCL2L2-      CDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGI
                           . .   .                                        

A0A3Q7QZT9_MCL1-01      --------------------------------------------------
A0A3Q7T511_BCL2L2-      STTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYS
A0A3Q7T511_BCL2L2-      STTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYS
A0A3Q7R8S3_BCL2L1-      DT-----------------------FVELYGNNAAAESRKGQERFNRWFL
A0A3Q7T511_BCL2L2-      STTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYS
                                                                          

A0A3Q7QZT9_MCL1-01      ------------------
A0A3Q7T511_BCL2L2-      PY----------------
A0A3Q7T511_BCL2L2-      PY----------------
A0A3Q7R8S3_BCL2L1-      TGMTVAGVVLLGSLFSRK
A0A3Q7T511_BCL2L2-      PY----------------
                                          

© 1998-2020Legal notice