Dataset for protein BCL-2-like of organism Vombatus ursinus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mlgpfkknaviglnlycggasapssgspllvpgkgttvessaprrdggeveagttttsaaaaaagelisgsggaslpdlv
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------ae-pdvrelvadyl-yklsqrgy----------t----------------------------ap---
pgvrgpprmaytg--vh-t-a----f-s---r-k--swsagpleap-spslpsvvyspppvgvrstrrsltplpl--egt
        tmmppyss-ynt-ttvk-vkfvr-r-qslpgtfngrpvat edeldgaeaeap kfpaqprhla  aerqdl
         dlkdrrryg-hqiaqgpih sqqmpflecdq eddnr p                               g
          hic mgee am  p   g cc ce fa a  aa gq e                                
          aa  lf       m   f                                                    
               a           d                                                    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                        .   . . .               
-------------p--------------------------s-l--hetip---vkqtlreagdeferryrrafsdltsql
etsstvngspswh-pdvhavsgalyeqslelitwyltghs-s-da--p--vaaahsamksvakdvsl--q---t-msal-
diptsaharnpst asseveedt             reqgpgvspvs-vrttvllrvqgr e gmr-wh-wt qg-ltkn
a     a  l pl  ppaeaaae             aaaaactnktprplskp fl   q    lqsnfetf ee crhd
                n                        a kdqkql qgk ae   a          dd dc ag  
                                             a         a                        
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          .  *      .   ****:..:. *.. :            .         :   :   :      *: .
hltpgsarqrfeqVveelfrdg-vNWGRivaffsFggalc-------vesvskemevlvgritswmatylvdhldpWiqe
-i---t----vtt snlvsqgrvt    vatlvv aavvlemeepqllrrrnpltsstsdsvaesltevidttkad lss
q-svv-pyrviss mtkm s eip    l viie   imi    kkkkhlkdrnrrpmirqlsyfivnf nrqirn  rq
ivlnqedqks kr adce e   i         a   f a       e h qi qmechep qle cd  mnn he  ik
dakde  igi ie          f                       a            e  d      ekk ga  hd
    d  e a                                                           e        
                                                                                

       330       340       350       360       370    
....:....|....:....|....:....|....:....|....:....|....
  **   .   :                                   .      
ngGWe-gfvelfgnnalses---r-g---firwvltg-mtvaglvtlgslfsrk
sk  dntvtspyevtqaep-rrt-e-qes----l--aafagvavllwalf-a-r
  vak hkn tqkmva-npflpqwtwrsvqt-im-lvqlkstkgv v-y-v-
  t e fhm spgfswgg    ksntp tlrgflv l dihg ic fasls 
    a   aah hfed   f    h dpa n nc k  a  g    a a lfl 
          f  dd    a          h c        f          i 
                                                      
© 1998-2020Legal notice