Dataset for protein BCL-2-like of organism Vombatus ursinus

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A4X2JXQ8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Vombatus ursinus GN=BCL2L1 (length=227 residues).
MSHGNRELVVDFLSYKLSQKGYSWSQFEDENRTEAPEGTEIPSTVNGSPSWHPADSHAVSGATGHSSSLDAHETIPVAAV
KQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMEVLVGRI
TSWMATYLDDHLDPWIQENGGWDTFVELYGNDAAAESRKGQERFNRWLLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A4X2K2M5_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Vombatus ursinus GN=BCL2L10 (length=188 residues).
MDYKCALREETAQLVADYLDYCCRREGFQERPPTTPAAATMRSVAKELRRRYQDFFECAQNQLLDQSPEQVIIEVAELMS
QGEFNWGRVAVLVVFAGALLEMEEPQKEERVQPLRREMSRRLTEELCNYLVEKKGAWLQEHGGWTGFHHHFTQKQSSPQS
DPSSTLCCIMAAAAGFGLVGLALLLAVR
>gnl|bcl2dbpro|A0A4X2KFL7_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Vombatus ursinus GN=BCL2A1 (length=172 residues).
MADYEFHYVHMLAQDYLKYVQQMPQLGSCLNKTSQILQKVAFSVQGEVEKDMETCLSTLDIASVDSARRIFKSVMEKEFE
DGIINWGRIVTIFAFGGILIKKLLRHRSPLTMSTHEEVSYFIAEFIMNNIAEWIRQNGGWENGFVKNFEPNMVWPNFTDI
STKIWGVFSFLK
>gnl|bcl2dbpro|A0A4X2KZ04_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Vombatus ursinus GN=BCL2L1 (length=185 residues).
PQTPAPEGTETSTVNGSPSWHPADNHAVSGATGHSSSLDAHETIPVAAVKQALKEAGDEFELWYRWAFSDLTSHFEQVVN
ELFRDRVNWGRIVAFFSFGGALCVERVDKEMEVLVGRITSWMATYLDDHLDPWISENGGWDTFAEPYENNAAAESREGQE
SFIRWLLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A4X2L5Q0_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Vombatus ursinus GN=BCL-2 (length=256 residues).
MAHPGRRGYDNREIVMKYIHYKLSQRGYEWDAGNLRAPASPSLPSVVASAPAVGVFSTQPRHTPLPAEPQDLATSTTAAA
RNSPLPPPPAVAAATAAAGPAVSPVPPVVHLTLRQAGDDFSRRYRRDFDEMSGQLHLTPVTARGRFATVVEELFRDGVNW
GRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHNWIQDNGGWVAKVFSMFSFTFLSPFPFTPHWTTPFHQR
GFKVLLQVKHLLTCAF
>gnl|bcl2dbpro|A0A4X2LDA7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Vombatus ursinus GN=MCL-1 (length=355 residues).
MLGPFKKNAVIGLNLYCGGASAPSSGSPLLVPGKGTTVESSAPRRDGGEVEAGTTTTSAAAAAAGELISGSGGASLPDLV
PGVRGPPRTALIGAEVPDVTATTPGPLFFSRSCRFSLPAAGAADAVTSPEDELDGYEPEPPGKRPARRSLLALPLAREGG
DTSSSAHGSLPSTPPSVEEEEDELYEQSLELITWYLREQAAGTKDAKPLRSGKALETLRRVADGVQRNHETAFQGMLRKL
DIKNEEDIKAVSRVVTCVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIDPLAESLTDVLVKTKRDWLIKQKGWEGF
VEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A4X2LP96_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Vombatus ursinus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYACGTGPGEGPTTEPLHRAMRAAGDEFESRFQRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETQLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
© 1998-2020Legal notice