Dataset for protein BCL-2-like of organism Vombatus ursinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4X2LDA7_MCL1-01      MLGPFKKNAVIGLNLYCGGASAPSSGSPLLVPGKGTTVESSAPRRDGGEV
A0A4X2L5Q0_BCL2-01      --------------------------------------------------
A0A4X2KFL7_BCL2A1-      --------------------------------------------------
A0A4X2K2M5_BCL2L10      --------------------------------------------------
A0A4X2LP96_BCL2L2-      --------------------------------------------------
A0A4X2JXQ8_BCL2L1-      --------------------------------------------------
A0A4X2KZ04_BCL2L1-      --------------------------------------------------
                                                                          

A0A4X2LDA7_MCL1-01      EAGTTTTSAAAAAAGELISGSGGASLPDLVPGVRGPPRTALIGAEVPDVT
A0A4X2L5Q0_BCL2-01      --------------------------------------MAHPGRRGYDNR
A0A4X2KFL7_BCL2A1-      ----------------------------------------MADYEFHYVH
A0A4X2K2M5_BCL2L10      --------------------------------------MDYKCALREETA
A0A4X2LP96_BCL2L2-      ---------------------------------------MATPASAPDTR
A0A4X2JXQ8_BCL2L1-      --------------------------------------------MSHGNR
A0A4X2KZ04_BCL2L1-      --------------------------------------------------
                                                                          

A0A4X2LDA7_MCL1-01      ATTPGPLFFSRSCRFSLPAAGAADAVTSPEDELDGYEPEPPGKRPARRSL
A0A4X2L5Q0_BCL2-01      EIVMKYIHYKLSQRGYEWDAGNLRAPASPSLPSVVASAPAVGVFSTQPRH
A0A4X2KFL7_BCL2A1-      MLAQDYLKYVQQMPQL----------------------------------
A0A4X2K2M5_BCL2L10      QLVADYLDYCCRREGF----------------------------------
A0A4X2LP96_BCL2L2-      ALVADFVGYKLRQKGYACGTGPGEGPTT----------------------
A0A4X2JXQ8_BCL2L1-      ELVVDFLSYKLSQKGYSWSQFEDENRTE----------------------
A0A4X2KZ04_BCL2L1-      ------------------------PQTP----------------------
                                                                          

A0A4X2LDA7_MCL1-01      LALPLAREGGDTSSSAHGSLPSTPPSVEEEEDELYEQSLELITWYLREQA
A0A4X2L5Q0_BCL2-01      TPLPAEPQDLATSTTAAARNSPLPPPPAVAAAT-------------AAAG
A0A4X2KFL7_BCL2A1-      -------------------------------------------------G
A0A4X2K2M5_BCL2L10      --------------------------------------------------
A0A4X2LP96_BCL2L2-      -----EP-------------------------------------------
A0A4X2JXQ8_BCL2L1-      -----APEGTEIPSTVNGSPSWHPADSHAVSGA-------------TGHS
A0A4X2KZ04_BCL2L1-      -----APEGTET-STVNGSPSWHPADNHAVSGA-------------TGHS
                                                                          

A0A4X2LDA7_MCL1-01      AGTKDAKPLRSGKALETLRRVADGVQRNHETAFQGMLRKLDIKNEEDIKA
A0A4X2L5Q0_BCL2-01      PAVSPVPPV----VHLTLRQAGDDFSRRYRRDFDEMSGQLHLTPVTARGR
A0A4X2KFL7_BCL2A1-      SCLNKTSQILQKVAFSVQGEVEKDME-------TCLSTLDIASVDSARRI
A0A4X2K2M5_BCL2L10      -----QERPPTTPAAATMRSVAKELRRRYQDFFE--CAQNQLLDQSPEQV
A0A4X2LP96_BCL2L2-      -------------LHRAMRAAGDEFESRFQRTFSDLAAQLHVTPGSAQQR
A0A4X2JXQ8_BCL2L1-      SSLDAHETIPVAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQS
A0A4X2KZ04_BCL2L1-      SSLDAHETIPVAAVKQALKEAGDEFELWYRWAFSDLTSH-----------
                                        .   . . .                         

A0A4X2LDA7_MCL1-01      VSRVVTCVFSDGVTNWGRIVTLISFGAFVA-------KHLKSINQESCID
A0A4X2L5Q0_BCL2-01      FATVVEELFRDG-VNWGRIVAFFEFGGVMC-------VESVNREMSPLVD
A0A4X2KFL7_BCL2A1-      FKSVMEKEFEDGIINWGRIVTIFAFGGILI----KKLLRHRSPLTMSTHE
A0A4X2K2M5_BCL2L10      IIEVAELMSQGE-FNWGRVAVLVVFAGALLEMEEPQKEERVQPLRREMSR
A0A4X2LP96_BCL2L2-      FTQVSDELFQGG-PNWGRLVAFFVFGAALC-------AESVNKEMEPLVG
A0A4X2JXQ8_BCL2L1-      FEQVVNELFRDG-VNWGRIVAFFSFGGALC-------VESVDKEMEVLVG
A0A4X2KZ04_BCL2L1-      FEQVVNELFRDR-VNWGRIVAFFSFGGALC-------VERVDKEMEVLVG
                        .  *      .   ****:..:. *.. :            .        

A0A4X2LDA7_MCL1-01      PLAESLTDVLVKTKRDWLIKQKGWE-GFVEFFHVEDLEGG----------
A0A4X2L5Q0_BCL2-01      SIALWMTEYLNRHLHNWIQDNGGWVAKVFSMFSFTFLSPFPFTPHWTTPF
A0A4X2KFL7_BCL2A1-      EVSYFIAEFIMNNIAEWIRQNGGWENGFVKNFEPNMVWPN----------
A0A4X2K2M5_BCL2L10      RLTEELCNYLVEKKGAWLQEHGGWT-GFHHHFTQKQSS-----PQSDPSS
A0A4X2LP96_BCL2L2-      QVQDWMVTYLETQLADWIHSSGGWA-EFTALYGDGALEEARRLREGNWAS
A0A4X2JXQ8_BCL2L1-      RITSWMATYLDDHLDPWIQENGGWD-TFVELYGNDAAAES---RKGQERF
A0A4X2KZ04_BCL2L1-      RITSWMATYLDDHLDPWISENGGWD-TFAEPYENNAAAES---REGQESF
                         :   :   :      *: .  **   .   :                  

A0A4X2LDA7_MCL1-01      IRNVLLA-FAGVAGVGAGLAYLIR
A0A4X2L5Q0_BCL2-01      HQRGFKVLLQVKHLLTCAF-----
A0A4X2KFL7_BCL2A1-      --------FTDISTKIWGVFSFLK
A0A4X2K2M5_BCL2L10      TLCCIMAAAAGFGLVGLALLLAVR
A0A4X2LP96_BCL2L2-      VRTVLTGAVALGALVTVGAFFASK
A0A4X2JXQ8_BCL2L1-      NRWLLTG-MTVAGVVLLGSLFSRK
A0A4X2KZ04_BCL2L1-      IRWLLTG-MTVAGVVLLGSLFSRK
                                         .      

© 1998-2020Legal notice