Dataset for protein Mcl-1 of organism Suricata suricatta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************                                            
MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLavgkeatarrevgggeagaviggsagasppatfapdarrvarps
                                    --------------------------------------------
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
pigaegpdvtatspkllfyaatrcasppeemegpaadaimspeeeldgyepeplgkrpavlpllelvgeasggpgtdgsl
--------------------------------------------------------------------------------
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                             ***************************************************
pstpppveeeedelfrqsleiisrylreqATGAKDGKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
-----------------------------                                                   
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************************************************ :* :*.:
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGW-dGfvEff
                                                                        aq pl vw
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :*        :* *. ..                                                             
hvE--------dLeGgirnvllafagvagvg---agsayl----------------------------------------
ll vetwtqtse p sdkgspg---------spa--l---yslwrppgvrhgpphsqgrlrtvagflshtqqstveevma
                      crlatqtp ll sr-gh irdllia st                              
                          cg g    h   d dl      i                               

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
nsptplaaptphgalrvgepprawirrhppappvpgpltqdlpqslpgqlrdsvcwragwacgsgpqplaqclicfmdgg
                                                                                
                                                                                

       490   
....:....|...
             
-------------
ctrdlihekasad
             
             
© 1998-2020Legal notice