Dataset for protein Mcl-1 of organism Suricata suricatta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*************************************                                           
MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLAvgkeatarrevgggeagaviggsagasppatfapdarrvarps
                                     -------------------------------------------
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
pigaegpdvtatspkllfyaatrcasppeemegpaadaimspeeeldgyepeplgkrpavlpllelvgeasggpgtdgsl
--------------------------------------------------------------------------------
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                              **************************************************
pstpppveeeedelfrqsleiisrylreqaTGAKDGKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
------------------------------                                                  
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************************************************ :* :*.:
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGW-dGfvEff
                                                                        aq pl vw
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :*                                                                             
hvEd----------------------------------------------------------------------------
ll vetwtqtselpgsdkgvpgcrlacqggglpahrsahlyllwlppgsthgpphsqgrlrtvagflshtqqstveevma
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------leggirnvllafagva-vgsgla------------
nsptplaaptphgalrvgepprawirrhppappvpgpltqdlpqs----------------g--a---plaqclicfmsg
                                              p ql dsvcwr  wgtp - pq          d 
                                                           t  c                 

       490    
....:....|....
              
----------ysir
sgtrdsilrkalvl
gcdl ldhei-gld
            a 
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice