Dataset for protein Mcl-1 of organism Suricata suricatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A673TBH1_MCL1-05      MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLL--------------
A0A673TBH1_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLAVGKEATARREVGG
A0A673TBH1_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLAVGKEATARREVGG
A0A673TBH1_MCL1-04      MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLAVGKEATARREVGG
A0A673TBH1_MCL1-03      MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLAVGKEATARREVGG
                        ************************************              

A0A673TBH1_MCL1-05      --------------------------------------------------
A0A673TBH1_MCL1-01      GEAGAVIGGSAGASPPATFAPDARRVARPSPIGAEGPDVTATSPKLLFYA
A0A673TBH1_MCL1-02      GEAGAVIGGSAGASPPATFAPDARRVARPSPIGAEGPDVTATSPKLLFYA
A0A673TBH1_MCL1-04      GEAGAVIGGSAGASPPATFAPDARRVARPSPIGAEGPDVTATSPKLLFYA
A0A673TBH1_MCL1-03      GEAGAVIGGSAGASPPATFAPDARRVARPSPIGAEGPDVTATSPKLLFYA
                                                                          

A0A673TBH1_MCL1-05      --------------------------------------------------
A0A673TBH1_MCL1-01      ATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
A0A673TBH1_MCL1-02      ATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
A0A673TBH1_MCL1-04      ATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
A0A673TBH1_MCL1-03      ATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
                                                                          

A0A673TBH1_MCL1-05      ---------------------------------------ATGAKDGKPLG
A0A673TBH1_MCL1-01      SGGPGTDGSLPSTPPPVEEEEDELFRQSLEIISRYLREQATGAKDGKPLG
A0A673TBH1_MCL1-02      SGGPGTDGSLPSTPPPVEEEEDELFRQSLEIISRYLREQATGAKDGKPLG
A0A673TBH1_MCL1-04      SGGPGTDGSLPSTPPPVEEEEDELFRQSLEIISRYLREQATGAKDGKPLG
A0A673TBH1_MCL1-03      SGGPGTDGSLPSTPPPVEEEEDELFRQSLEIISRYLREQATGAKDGKPLG
                                                               ***********

A0A673TBH1_MCL1-05      GSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A673TBH1_MCL1-01      GSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A673TBH1_MCL1-02      GSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A673TBH1_MCL1-04      GSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A673TBH1_MCL1-03      GSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
                        **************************************************

A0A673TBH1_MCL1-05      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
A0A673TBH1_MCL1-01      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
A0A673TBH1_MCL1-02      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
A0A673TBH1_MCL1-04      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
A0A673TBH1_MCL1-03      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
                        **************************************************

A0A673TBH1_MCL1-05      TKRDWLVKQRGW-DGFVEFFHVE--------DLEGGIRNVLLAFAGVAGV
A0A673TBH1_MCL1-01      TKRDWLVKQRGWAQGPLEVWLLEVETWTQTSELPGSDKGVPGCRLACQGG
A0A673TBH1_MCL1-02      TKRDWLVKQRGWAQGPLEVWLLEVETWTQTSELPGSDKGSLL--------
A0A673TBH1_MCL1-04      TKRDWLVKQRGW-DGFVEFFHVE--------DLEGGIRNVLLAFAGVAGV
A0A673TBH1_MCL1-03      TKRDWLVKQRGW-DGFVEFFHVE--------DLEGGIRNVLLAFAGTGTP
                        ************ :* :*.: :*        :* *. ..           

A0A673TBH1_MCL1-05      G---AGLAYLIR--------------------------------------
A0A673TBH1_MCL1-01      GLPAHRSAHLYLLWLPPGSTHGPPHSQGRLRTVAGFLSHTQQSTVEEVMA
A0A673TBH1_MCL1-02      --------------------------------------------------
A0A673TBH1_MCL1-04      G---AGLAYL--------IR------------------------------
A0A673TBH1_MCL1-03      GSLASGSGDLDSDLRIAGVR------------------------------
                                                                          

A0A673TBH1_MCL1-05      --------------------------------------------------
A0A673TBH1_MCL1-01      NSPTPLAAPTPHGALRVGEPPRAWIRRHPPAPPVPGPLTQDLPQSLPGQL
A0A673TBH1_MCL1-02      --------------------------------------------------
A0A673TBH1_MCL1-04      --------------------------------------------------
A0A673TBH1_MCL1-03      --------------------------------------------------
                                                                          

A0A673TBH1_MCL1-05      -------------------------------------------
A0A673TBH1_MCL1-01      RDSVCWRAGWACGSGPQPLAQCLICFMDGGCTRDLIHEKASAD
A0A673TBH1_MCL1-02      -------------------------------------------
A0A673TBH1_MCL1-04      -------------------------------------------
A0A673TBH1_MCL1-03      -------------------------------------------
                                                                   

© 1998-2020Legal notice