Dataset for protein Mcl-1 of organism Suricata suricatta

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A673TBH1_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Suricata suricatta GN=MCL-1 (length=342 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLAVGKEATARREVGGGEAGAVIGGSAGASPPATFAPDARRVARPS
PIGAEGPDVTATSPKLLFYAATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASGGPGTDGSL
PSTPPPVEEEEDELFRQSLEIISRYLREQATGAKDGKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWAQGPLEVW
LLEVETWTQTSELPGSDKGSLL
>gnl|bcl2dbpro|A0A673TBH1_MCL1-05 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Suricata suricatta GN=MCL-1 (length=197 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLATGAKDGKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A673TBH1_MCL1-04 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Suricata suricatta GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLAVGKEATARREVGGGEAGAVIGGSAGASPPATFAPDARRVARPS
PIGAEGPDVTATSPKLLFYAATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASGGPGTDGSL
PSTPPPVEEEEDELFRQSLEIISRYLREQATGAKDGKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A673TBH1_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Suricata suricatta GN=MCL-1 (length=361 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLAVGKEATARREVGGGEAGAVIGGSAGASPPATFAPDARRVARPS
PIGAEGPDVTATSPKLLFYAATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASGGPGTDGSL
PSTPPPVEEEEDELFRQSLEIISRYLREQATGAKDGKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGTGTPGSLASGSGDLDSDLRIAGVR
>gnl|bcl2dbpro|A0A673TBH1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Suricata suricatta GN=MCL-1 (length=493 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLAVGKEATARREVGGGEAGAVIGGSAGASPPATFAPDARRVARPS
PIGAEGPDVTATSPKLLFYAATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASGGPGTDGSL
PSTPPPVEEEEDELFRQSLEIISRYLREQATGAKDGKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWAQGPLEVW
LLEVETWTQTSELPGSDKGVPGCRLACQGGGLPAHRSAHLYLLWLPPGSTHGPPHSQGRLRTVAGFLSHTQQSTVEEVMA
NSPTPLAAPTPHGALRVGEPPRAWIRRHPPAPPVPGPLTQDLPQSLPGQLRDSVCWRAGWACGSGPQPLAQCLICFMDGG
CTRDLIHEKASAD
© 1998-2020Legal notice