Dataset for protein BCL-2-like of organism Suricata suricatta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------------------------------s
mfglkrnaviglnlycggaglgagsggasssgggllavgkeatarrevgggeagaviggsagasppatfapdarrvarp-
                                               mad  f f l           l q ym    mm
                                                                               a
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
pigaegpdvtatspkllfyaatrcgsppe--------------------------------------g-a---pgtdgsl
---------r-lv-df---kl-q-a----emegpaadaimspeeeldgyepeplgkrpavlpllelv-e-sgg--g-a-a
atprtsytn-e--v--vs --s-k-yvwsqfs                                dveenrtea p-p-r-
hd lserst  ilt yih c rar  scg                                     a d ga  esvepv
 a  raq a    m   g     p  e d                                             a t hg
    m        a   e                                                            ee
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                       .:. ..  ..      :        
pstpppv----------------------atgakdgkplggsgaasrk----aletLRrvgdgvqrnhetafqgmlrkld
----s--eeeedelfrqsleiisrylreq-------------------vppvvhqvmqyaatefetryrrtlsdl-sq-h
mqvs-sqpgrtswhlad pavxxxxxxxxxxxxxxvi maaa pqpsr    lsla  q  ss sqsvqqk rpwt--v-
lgid a n nppl       angatghsssld reaa a      l p    ek    g   q  lef ef anfsdt s
 ea                                                  a    e   d  g    d  e aa   
 a                                                        a                     
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          .  *      :  .    .** :.:.: * . :                                :   :
ikneddvks-lsrVm--vhvFsdGv--tNWGRIVtlisFgafvakhlk---sinqesciep--------------laesi
vtpgtaqqrvfaq vrleellrpdpqn-s  ylaaffv egvlcvesvpgnnkemsplvdqvtewetnvdqdcqrivawm
--svyryrt vtt s  nry qg    v       vli a amlerpp   drtlqvdqsrrq            vstyl
lvrfs rn   ql g  dke               e   t  ak l   rlrak   gndl            m llv
      ag                         a              e  a    a                hf 
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   :      *:    **                                                              
tdvLvrtkrdWlvkqrGW-dgfvef--------------e--------dleggirnvllafagvagvg-l-aylgrl---
atyvndhl-- iqsng  aqaplqlygpnrisiflswlv-vetwtqlse-sw--krtfxtg-l-g--vv-gsgsah-ylx
eer me--ht  rqsn  vithtlvfsvs       mhlasrkgqrtrpyp-ss-kwvg--x-x-xx-lxa--f--kxxs
c f a rtgp  heh    ae sayqksg       fqd l eerprfni-rqdvgsp xxmxtxtpxxtxxx-xyxrsl
       hee  ed        c   hne       aaa    aeiil gn lglac  vrlvlscgttpvlrysxsk d
         a   a             d                 e   ff a   a  sq tcqaclsmlhlxllrd  
                                                           cl aal a agigi id    
                                                                        a fa    

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
xxxxgxrxxxxxtshrlstvtshlsstqqstvefvmvntstplsdpttshdlsvvftsrdwsrvitsqppvpvpttqdls
wrppxvxhgpphsqggfrd agfdfhdiiasrdesdaisphgfaaiiphgafrdgepphafidrhppagfsdgilsh fp
llia st                                                                         
     i                                                                          
                                                                                
                                                                                
                                                                                

       490       500       510       520       530
....:....|....:....|....:....|....:....|....:....|
                                                  
--------------------------------------------------
qvlpsqlrssvmwshgwsdvstsqplsqvltyfprsqctrdlihekasad
dsfaghdfdd cara facgigphgfadciic mdgg             
                                                  
                                                  
                                                  
                                                  
                                                  
© 1998-2020Legal notice