Dataset for protein BCL-2-like of organism Suricata suricatta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfglkrnaviglnlycggaglgagsggasssgggllavgkeatarrevgggeagaviggsagasppatfapdarrvarps
                                               mad  f f l           l q ym    ma
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----g-d------k-l-y----------------------------gyepeplg-r-a---l-elvgeasggpg-----
pigae-p-vtatsp-l-f-aatrcasppeemegpaadaimspeeeld--------k-p-vlp-l--------a--yvcga
ha rtsysnrelvvdyis klsq                       r  mwdqfsepttralvtdfleyrtr-kp     
    m q    i m f h                            k  sat ara d     a ve nkleq e     
                                                   s              a dcga        
                                                                      a         
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                            .:. ..  ..      :   
tdgslpstpppv----------------------atgakdgkplggsgaasrk----aletLRrvgdgvqrnhetafqgm
g-a-a----s--eeeedelfrqsleiisrylreq-------------------vppvvhqvmqyaatefetryrrtlsdl
-p-r-mqvs-sqpgrtswhlad pavxxxxxxxxxxxxxxvi maaa pqpsr    lsla  q  ss sqsvqqk rpw
svepvlgid a n nppl       angatghsssld reaa a      l p    ek    g   q  lef ef anf
 t hg ea                                                  a    e   d  g    d  e 
   ee a                                                        a                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               .  *      :  .    .** :.:.: * . :                                
lrkldikneddvks-lsrVm--vhvFsdGv--tNWGRIVtlisFgafvakhlk---sinqesciep--------------
-sq-hvtpgtaqqrvfaq vrleellrpdpqn-s  ylaaffv egvlcvesvpgnnkemsplvdqvtewetnvdqdcqr
t--v---svyryrt vtt s  nry qg    v       vli a amlerpp   drtlqvdqsrrq            
sdt slvrfs rn   ql g  dke               e   t  ak l   rlrak   gndl            
aa         ag                         a              e  a    a              
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:   :   :      *:    **                                                         
laesitdvLvrtkrdWlvkqrGW-dgfvef--------------e--------dleggirnvllafagvagvg-l-aylg
ivawmatyvndhl-- iqsng  aqaplqlygpnrisiflswlv-vetwtqlse-sw--krtfxtg-l-g--vv-gsgsa
vstyleer me--ht  rqsn  vithtlvfsvs       mhlasrkgqrtrpyp-ss-kwvg--x-x-xx-lxa--f-
m llvc f a rtgp  heh    ae sayqksg       fqd l eerprfni-rqdvgsp xxmxtxtpxxtxxx-x
  hf        hee  ed        c   hne       aaa    aeiil gn lglac  vrlvlscgttpvlrys
              a   a             d                 e   ff a   a  sq tcqaclsmlhlxl
                                                                cl aal a agigi i
                                                                             a f

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
rl------------------------------------------------------------------------------
h-ylxxxxxgxrxxxxxtshrlstvtshlsstqqstvefvmvntstplsdpttshdlsvvftsrdwsrvitsqppvpvpt
-kxxswrppxvxhgpphsqggfrd agfdfhdiiasrdesdaisphgfaaiiphgafrdgepphafidrhppagfsdgil
yxrslllia st                                                                    
xsk d     i                                                                     
lrd                                                                             
d                                                                               
a                                                                               

       490       500       510       520       530     
....:....|....:....|....:....|....:....|....:....|....:
                                                       
-------------------------------------------------------
tqdlsqvlpsqlrssvmwshgwsdvstsqplsqvltyfprsqctrdlihekasad
sh fpdsfaghdfdd cara facgigphgfadciic mdgg             
                                                       
                                                       
                                                       
                                                       
                                                       
© 1998-2021Legal notice