Dataset for protein BCL-2-like of organism Suricata suricatta

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A673TBH1_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Suricata suricatta GN=MCL-1 (length=342 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLAVGKEATARREVGGGEAGAVIGGSAGASPPATFAPDARRVARPS
PIGAEGPDVTATSPKLLFYAATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASGGPGTDGSL
PSTPPPVEEEEDELFRQSLEIISRYLREQATGAKDGKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWAQGPLEVW
LLEVETWTQTSELPGSDKGSLL
>gnl|bcl2dbpro|A0A673TBH1_MCL1-05 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Suricata suricatta GN=MCL-1 (length=197 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLATGAKDGKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A673TBH1_MCL1-04 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Suricata suricatta GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLAVGKEATARREVGGGEAGAVIGGSAGASPPATFAPDARRVARPS
PIGAEGPDVTATSPKLLFYAATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASGGPGTDGSL
PSTPPPVEEEEDELFRQSLEIISRYLREQATGAKDGKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A673TBH1_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Suricata suricatta GN=MCL-1 (length=361 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLAVGKEATARREVGGGEAGAVIGGSAGASPPATFAPDARRVARPS
PIGAEGPDVTATSPKLLFYAATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASGGPGTDGSL
PSTPPPVEEEEDELFRQSLEIISRYLREQATGAKDGKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGTGTPGSLASGSGDLDSDLRIAGVR
>gnl|bcl2dbpro|A0A673TBH1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Suricata suricatta GN=MCL-1 (length=493 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLAVGKEATARREVGGGEAGAVIGGSAGASPPATFAPDARRVARPS
PIGAEGPDVTATSPKLLFYAATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASGGPGTDGSL
PSTPPPVEEEEDELFRQSLEIISRYLREQATGAKDGKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWAQGPLEVW
LLEVETWTQTSELPGSDKGVPGCRLACQGGGLPAHRSAHLYLLWLPPGSTHGPPHSQGRLRTVAGFLSHTQQSTVEEVMA
NSPTPLAAPTPHGALRVGEPPRAWIRRHPPAPPVPGPLTQDLPQSLPGQLRDSVCWRAGWACGSGPQPLAQCLICFMDGG
CTRDLIHEKASAD
>gnl|bcl2dbpro|A0A673TDC6_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Suricata suricatta GN=BCL2A1 (length=316 residues).
MADGEFGFVLTLAQDYMGHVLQVPPPQPSRASEVLQGVASSVQGEVEEKLRPWLDTVSVVSVDAARTVFQQVMEKEFEDG
VVNWGRIVTVFAFEGVLLKKLLRERAAPDVDARTVSHFVAEFVVRHTGEWIRQNGGWVIAHSQYQKSNRISIFLSMQDEV
ETEEIIRDIFRQGKACFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSHGFSDVTSHDFSDIIASRDFSDVITSH
GFSDIITSHDFSDVFTSHDFSDVITSQGFSDVITSHDFSDVFASHDFSDVMASHGFSDVITSHGFSDVITYFPRSQ
>gnl|bcl2dbpro|A0A673UC80_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Suricata suricatta GN=BCL2L10 (length=192 residues).
MADPLRERTARLLTDFLEYCARAPGSPARAPSTPEAEVLRYVATQVQQSHQQFLSNFRGYRQNRVALVGRLERYLLPDPQ
NVSWGYIAALLIFAGTLLERPPPGNDLTLKPDQEQDLEWETNVDQDCQRLVALLCDRLMERHRAWLEAHNGWDGFCLFFS
PLLPYSWKTLLVQALLSCVTVMILIYLLRRLS
>gnl|bcl2dbpro|A0A673UUI0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Suricata suricatta GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAVNGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A673VAY7_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Suricata suricatta GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A673VDM8_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Suricata suricatta GN=BCL-2 (length=239 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGVAPAPGISSSQPGRTPLPAAXXXXXXXXXXXXXXAAPAA
AAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACVTLGAYLGHK
© 1998-2020Legal notice