Dataset for protein BCL-2-like of organism Suricata suricatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A673TBH1_MCL1-05      MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLL--------------
A0A673UC80_BCL2L10      --------------------------------------------------
A0A673VAY7_BCL2L2-      --------------------------------------------------
A0A673TDC6_BCL2A1-      -----------------------------------------------MAD
A0A673TBH1_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLAVGKEATARREVGG
A0A673TBH1_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLAVGKEATARREVGG
A0A673TBH1_MCL1-04      MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLAVGKEATARREVGG
A0A673TBH1_MCL1-03      MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLAVGKEATARREVGG
A0A673UUI0_BCL2L1-      --------------------------------------------------
A0A673VDM8_BCL2-01      --------------------------------------------------
                                                                          

A0A673TBH1_MCL1-05      --------------------------------------------------
A0A673UC80_BCL2L10      -----------------------------MADPLRERTAR-LLTDFLEYC
A0A673VAY7_BCL2L2-      -----------------------------MATPASAPDTRALVADFVGYK
A0A673TDC6_BCL2A1-      GEFGFVL----------TLAQDYM--------------------------
A0A673TBH1_MCL1-01      GEAGAVIGGSAGASPPATFAPDARRVARPSPIGAEGPDVTATSPKLLFYA
A0A673TBH1_MCL1-02      GEAGAVIGGSAGASPPATFAPDARRVARPSPIGAEGPDVTATSPKLLFYA
A0A673TBH1_MCL1-04      GEAGAVIGGSAGASPPATFAPDARRVARPSPIGAEGPDVTATSPKLLFYA
A0A673TBH1_MCL1-03      GEAGAVIGGSAGASPPATFAPDARRVARPSPIGAEGPDVTATSPKLLFYA
A0A673UUI0_BCL2L1-      ----------------------------------MSQSNRELVVDFLSYK
A0A673VDM8_BCL2-01      ----------------------------MAHAGRTGYDNREIVMKYIHYK
                                                                          

A0A673TBH1_MCL1-05      --------------------------------------------------
A0A673UC80_BCL2L10      ARAPG---------------------------------------------
A0A673VAY7_BCL2L2-      LRQKGYVCG-----------------------------------------
A0A673TDC6_BCL2A1-      --------------------------------------------------
A0A673TBH1_MCL1-01      ATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
A0A673TBH1_MCL1-02      ATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
A0A673TBH1_MCL1-04      ATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
A0A673TBH1_MCL1-03      ATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
A0A673UUI0_BCL2L1-      LSQKGYSWSQFS--------------------------------DVEENR
A0A673VDM8_BCL2-01      LSQRGYEWD-------------------------------------AGDA
                                                                          

A0A673TBH1_MCL1-05      ---------------------------------------ATGAKDGKPLG
A0A673UC80_BCL2L10      -----SPARAPST-P-----------------------------------
A0A673VAY7_BCL2L2-      ----AGPGEGPAADP-----------------------------------
A0A673TDC6_BCL2A1-      -------GHVLQVPPP----------------------------------
A0A673TBH1_MCL1-01      SGGPGTDGSLPSTPPPVEEEEDELFRQSLEIISRYLREQATGAKDGKPLG
A0A673TBH1_MCL1-02      SGGPGTDGSLPSTPPPVEEEEDELFRQSLEIISRYLREQATGAKDGKPLG
A0A673TBH1_MCL1-04      SGGPGTDGSLPSTPPPVEEEEDELFRQSLEIISRYLREQATGAKDGKPLG
A0A673TBH1_MCL1-03      SGGPGTDGSLPSTPPPVEEEEDELFRQSLEIISRYLREQATGAKDGKPLG
A0A673UUI0_BCL2L1-      TEAPEGTESEMETPSAVNGNPSWHLADSPAVNGATGHSSSLDAREVIPMA
A0A673VDM8_BCL2-01      GAAPPGVAPAPGISSSQPGRTPL-----PAAXXXXXXXXXXXXXXAAPAA
                                                                          

A0A673TBH1_MCL1-05      GSGAASRK----ALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-
A0A673UC80_BCL2L10      ------------EAEVLRYVATQVQQSHQQFLSNF-------RGYRQNR-
A0A673VAY7_BCL2L2-      ------------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQR-
A0A673TDC6_BCL2A1-      ----QPSR----ASEVLQGVASSVQGEVEEKLRPWLDTVSVVSVDAARTV
A0A673TBH1_MCL1-01      GSGAASRK----ALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-
A0A673TBH1_MCL1-02      GSGAASRK----ALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-
A0A673TBH1_MCL1-04      GSGAASRK----ALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-
A0A673TBH1_MCL1-03      GSGAASRK----ALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-
A0A673UUI0_BCL2L1-      A-----------VKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQS-
A0A673VDM8_BCL2-01      AAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGR-
                                       .:. ..  ..      :                  

A0A673TBH1_MCL1-05      LSRVM--VHVFSDGV--TNWGRIVTLISFGAFVAKHLK---SINQESCIE
A0A673UC80_BCL2L10      VALVGRLERYLLPDPQNVSWGYIAALLIFAGTLLERPPPGNDLTLKPDQE
A0A673VAY7_BCL2L2-      FTQVS--DELFQGGP---NWGRLVAFFVFGAALCAESV---NKEMEPLVG
A0A673TDC6_BCL2A1-      FQQVM--EKEFEDGV--VNWGRIVTVFAFEGVLLKKLL---RERAAPDVD
A0A673TBH1_MCL1-01      LSRVM--VHVFSDGV--TNWGRIVTLISFGAFVAKHLK---SINQESCIE
A0A673TBH1_MCL1-02      LSRVM--VHVFSDGV--TNWGRIVTLISFGAFVAKHLK---SINQESCIE
A0A673TBH1_MCL1-04      LSRVM--VHVFSDGV--TNWGRIVTLISFGAFVAKHLK---SINQESCIE
A0A673TBH1_MCL1-03      LSRVM--VHVFSDGV--TNWGRIVTLISFGAFVAKHLK---SINQESCIE
A0A673UUI0_BCL2L1-      FEQVV--NELFRDGV---NWGRIVAFFSFGGALCVESV---DKEMQVLVS
A0A673VDM8_BCL2-01      FATVV--EELFRDGV---NWGRIVAFFEFGGVMCVESV---NREMSPLVD
                        .  *      :  .    .** :.:.: * . :                 

A0A673TBH1_MCL1-05      P--------------LAESITDVLVRTKRDWLVKQRGW-DGFVEFFHVE-
A0A673UC80_BCL2L10      QDLEWETNVDQDCQRLVALLCDRLMERHRAWLEAHNGW-DGFCLFFSP--
A0A673VAY7_BCL2L2-      QVQEW----------MVAYLETRLAD----WIHSSGGW-AEFTALYGDG-
A0A673TDC6_BCL2A1-      ART------------VSHFVAEFVVRHTGEWIRQNGGWVIAHSQYQKSNR
A0A673TBH1_MCL1-01      P--------------LAESITDVLVRTKRDWLVKQRGWAQGPLEV-----
A0A673TBH1_MCL1-02      P--------------LAESITDVLVRTKRDWLVKQRGWAQGPLEV-----
A0A673TBH1_MCL1-04      P--------------LAESITDVLVRTKRDWLVKQRGW-DGFVEF-----
A0A673TBH1_MCL1-03      P--------------LAESITDVLVRTKRDWLVKQRGW-DGFVEF-----
A0A673UUI0_BCL2L1-      R--------------IATWMATYLNDHLEPWIQENGGW-DTFVELYGNN-
A0A673VDM8_BCL2-01      N--------------IALWMTEYLNRHLHTWIQDNGGW-DAFVELYGPS-
                                       :   :   :      *:    **            

A0A673TBH1_MCL1-05      ------------------DLEGGIRNVLLAFAGVAGVGAGLAYLIR----
A0A673UC80_BCL2L10      ----------------LLPYSW---KTLLVQALLSCVTVMILIYLLRRLS
A0A673VAY7_BCL2L2-      ---------ALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK--
A0A673TDC6_BCL2A1-      ISIFLSMQDEVETEEIIRDIFRQGKACFXXXXXXXXXXXXXXXXXXXXXX
A0A673TBH1_MCL1-01      ------WLLEVETWTQTSELPGSDKGVPGCRLACQGGGLPAHRSAHLYLL
A0A673TBH1_MCL1-02      ------WLLEVETWTQTSELPGSDKGSLL---------------------
A0A673TBH1_MCL1-04      ------FHVE--------DLEGGIRNVLLAFAGVAGVG---AGLAYL---
A0A673TBH1_MCL1-03      ------FHVE--------DLEGGIRNVLLAFAGTGTPGSLASGSGDLDSD
A0A673UUI0_BCL2L1-      ------AAAESRKGQERFN------RWFLTGMTVAGVVLLGSLFSRK---
A0A673VDM8_BCL2-01      ------M-------QPLFDFSWLSLKALLSLALVGACVTLGAYLGHK---
                                                                          

A0A673TBH1_MCL1-05      --------------------------------------------------
A0A673UC80_BCL2L10      --------------------------------------------------
A0A673VAY7_BCL2L2-      --------------------------------------------------
A0A673TDC6_BCL2A1-      XXXXXXXXXXXXTSHGFSDVTSHDFSDIIASRDFSDVITSHGFSDIITSH
A0A673TBH1_MCL1-01      WLPPGSTHGPPHSQGRLRTVAGFLSHTQQSTVEEVMANSPTPLAAPTPHG
A0A673TBH1_MCL1-02      --------------------------------------------------
A0A673TBH1_MCL1-04      -----IR-------------------------------------------
A0A673TBH1_MCL1-03      LRIAGVR-------------------------------------------
A0A673UUI0_BCL2L1-      --------------------------------------------------
A0A673VDM8_BCL2-01      --------------------------------------------------
                                                                          

A0A673TBH1_MCL1-05      --------------------------------------------------
A0A673UC80_BCL2L10      --------------------------------------------------
A0A673VAY7_BCL2L2-      --------------------------------------------------
A0A673TDC6_BCL2A1-      DFSDVFTSHDFSDVITSQGFSDVITSHDFSDVFASHDFSDVMASHGFSDV
A0A673TBH1_MCL1-01      ALRVGEPPRAWIRRHPPAPPVPGPLTQDLPQSLPGQLRDSVCWRAGWACG
A0A673TBH1_MCL1-02      --------------------------------------------------
A0A673TBH1_MCL1-04      --------------------------------------------------
A0A673TBH1_MCL1-03      --------------------------------------------------
A0A673UUI0_BCL2L1-      --------------------------------------------------
A0A673VDM8_BCL2-01      --------------------------------------------------
                                                                          

A0A673TBH1_MCL1-05      ------------------------------
A0A673UC80_BCL2L10      ------------------------------
A0A673VAY7_BCL2L2-      ------------------------------
A0A673TDC6_BCL2A1-      ITSHGFSDVITYFPRSQ-------------
A0A673TBH1_MCL1-01      SGPQPLAQCLICFMDGGCTRDLIHEKASAD
A0A673TBH1_MCL1-02      ------------------------------
A0A673TBH1_MCL1-04      ------------------------------
A0A673TBH1_MCL1-03      ------------------------------
A0A673UUI0_BCL2L1-      ------------------------------
A0A673VDM8_BCL2-01      ------------------------------
                                                      

© 1998-2020Legal notice