Dataset for protein BCL-2-like of organism Suricata suricatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A673TBH1_MCL1-05      MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLL--------------
A0A673UC80_BCL2L10      --------------------------------------------------
A0A673VAY7_BCL2L2-      --------------------------------------------------
A0A673TDC6_BCL2A1-      -----------------------------------------------MAD
A0A673TBH1_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLAVGKEATARREVGG
A0A673TBH1_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLAVGKEATARREVGG
A0A673TBH1_MCL1-03      MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLAVGKEATARREVGG
A0A673TBH1_MCL1-04      MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGGLLAVGKEATARREVGG
A0A673UUI0_BCL2L1-      --------------------------------------------------
A0A673VDM8_BCL2-01      --------------------------------------------------
                                                                          

A0A673TBH1_MCL1-05      --------------------------------------------------
A0A673UC80_BCL2L10      --------------------------------------------------
A0A673VAY7_BCL2L2-      --------------------------------------------------
A0A673TDC6_BCL2A1-      GEFGFVL----------TLAQDYM--------------------------
A0A673TBH1_MCL1-01      GEAGAVIGGSAGASPPATFAPDARRVARPSPIGAEGPDVTATSPKLLFYA
A0A673TBH1_MCL1-02      GEAGAVIGGSAGASPPATFAPDARRVARPSPIGAEGPDVTATSPKLLFYA
A0A673TBH1_MCL1-03      GEAGAVIGGSAGASPPATFAPDARRVARPSPIGAEGPDVTATSPKLLFYA
A0A673TBH1_MCL1-04      GEAGAVIGGSAGASPPATFAPDARRVARPSPIGAEGPDVTATSPKLLFYA
A0A673UUI0_BCL2L1-      ----------------------------------MSQSNRELVVDFLSYK
A0A673VDM8_BCL2-01      ----------------------------MAHAGRTGYDNREIVMKYIHYK
                                                                          

A0A673TBH1_MCL1-05      --------------------------------------------------
A0A673UC80_BCL2L10      -----------------------------MADPLRERTAR-LLTDFLEYC
A0A673VAY7_BCL2L2-      -----------------------------MATPASAPDTRALVADFVGYK
A0A673TDC6_BCL2A1-      --------------------------------------------------
A0A673TBH1_MCL1-01      ATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
A0A673TBH1_MCL1-02      ATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
A0A673TBH1_MCL1-03      ATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
A0A673TBH1_MCL1-04      ATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
A0A673UUI0_BCL2L1-      LSQ-----------------------KGYSWSQFS---------DVEENR
A0A673VDM8_BCL2-01      LSQ-----------------------RGYEWD--------------AGDA
                                                                          

A0A673TBH1_MCL1-05      --------------------------------------------ATGAKD
A0A673UC80_BCL2L10      ARAPG-----SPARAPST-P------------------------------
A0A673VAY7_BCL2L2-      LRQKGYVCGAGPGEGPAADP------------------------------
A0A673TDC6_BCL2A1-      ------------GHVLQVPPP-----------------------------
A0A673TBH1_MCL1-01      SGGPG-----TDGSLPSTPPPVEEEEDELFRQSLEIISRYLREQATGAKD
A0A673TBH1_MCL1-02      SGGPG-----TDGSLPSTPPPVEEEEDELFRQSLEIISRYLREQATGAKD
A0A673TBH1_MCL1-03      SGGPG-----TDGSLPSTPPPVEEEEDELFRQSLEIISRYLREQATGAKD
A0A673TBH1_MCL1-04      SGGPG-----TDGSLPSTPPPVEEEEDELFRQSLEIISRYLREQATGAKD
A0A673UUI0_BCL2L1-      TEAPE-----GTESEMETPSAVNGNPSWHLADSPAVNGATGHSSSLDARE
A0A673VDM8_BCL2-01      GAAPP-----GVAPAPGISSSQPGRTPL-----PAAXXXXXXXXXXXXXX
                                                                          

A0A673TBH1_MCL1-05      GKPLGGSGAASRK----ALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
A0A673UC80_BCL2L10      -----------------EAEVLRYVATQVQQSHQQFLSNF-------RGY
A0A673VAY7_BCL2L2-      -----------------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGS
A0A673TDC6_BCL2A1-      ---------QPSR----ASEVLQGVASSVQGEVEEKLRPWLDTVSVVSVD
A0A673TBH1_MCL1-01      GKPLGGSGAASRK----ALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
A0A673TBH1_MCL1-02      GKPLGGSGAASRK----ALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
A0A673TBH1_MCL1-03      GKPLGGSGAASRK----ALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
A0A673TBH1_MCL1-04      GKPLGGSGAASRK----ALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
A0A673UUI0_BCL2L1-      VIPMAA-----------VKQALREAGDEFELRYRRAFSDLTSQLHITPGT
A0A673VDM8_BCL2-01      AAPAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFT
                                            .:. ..  ..      :             

A0A673TBH1_MCL1-05      DVKS-LSRVM--VHVFSDGV--TNWGRIVTLISFGAFVAKHLK---SINQ
A0A673UC80_BCL2L10      RQNR-VALVGRLERYLLPDPQNVSWGYIAALLIFAGTLLERPPPGNDLTL
A0A673VAY7_BCL2L2-      AQQR-FTQVS--DELFQGGP---NWGRLVAFFVFGAALCAESV---NKEM
A0A673TDC6_BCL2A1-      AARTVFQQVM--EKEFEDGV--VNWGRIVTVFAFEGVLLKKLL---RERA
A0A673TBH1_MCL1-01      DVKS-LSRVM--VHVFSDGV--TNWGRIVTLISFGAFVAKHLK---SINQ
A0A673TBH1_MCL1-02      DVKS-LSRVM--VHVFSDGV--TNWGRIVTLISFGAFVAKHLK---SINQ
A0A673TBH1_MCL1-03      DVKS-LSRVM--VHVFSDGV--TNWGRIVTLISFGAFVAKHLK---SINQ
A0A673TBH1_MCL1-04      DVKS-LSRVM--VHVFSDGV--TNWGRIVTLISFGAFVAKHLK---SINQ
A0A673UUI0_BCL2L1-      AYQS-FEQVV--NELFRDGV---NWGRIVAFFSFGGALCVESV---DKEM
A0A673VDM8_BCL2-01      ARGR-FATVV--EELFRDGV---NWGRIVAFFEFGGVMCVESV---NREM
                             .  *      :  .    .** :.:.: * . :            

A0A673TBH1_MCL1-05      ESCIEP--------------LAESITDVLVRTKRDWLVKQRGW-DGFVEF
A0A673UC80_BCL2L10      KPDQEQDLEWETNVDQDCQRLVALLCDRLMERHRAWLEAHNGW-DGFCLF
A0A673VAY7_BCL2L2-      EPLVGQVQEW----------MVAYLETRLAD----WIHSSGGW-AEFTAL
A0A673TDC6_BCL2A1-      APDVDART------------VSHFVAEFVVRHTGEWIRQNGGWVIAHSQY
A0A673TBH1_MCL1-01      ESCIEP--------------LAESITDVLVRTKRDWLVKQRGWAQGPLEV
A0A673TBH1_MCL1-02      ESCIEP--------------LAESITDVLVRTKRDWLVKQRGWAQGPLEV
A0A673TBH1_MCL1-03      ESCIEP--------------LAESITDVLVRTKRDWLVKQRGW-DGFVEF
A0A673TBH1_MCL1-04      ESCIEP--------------LAESITDVLVRTKRDWLVKQRGW-DGFVEF
A0A673UUI0_BCL2L1-      QVLVSR--------------IATWMATYLNDHLEPWIQENGGW-DTFVEL
A0A673VDM8_BCL2-01      SPLVDN--------------IALWMTEYLNRHLHTWIQDNGGW-DAFVEL
                                            :   :   :      *:    **       

A0A673TBH1_MCL1-05      FHVE-------------------DLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A673UC80_BCL2L10      FSP------------------LLPYSW---KTLLVQALLSCVTVMILIYL
A0A673VAY7_BCL2L2-      YGDG----------ALEEARRLREGNWASVRTVLTGAVALGALVTVGAFF
A0A673TDC6_BCL2A1-      QKSNRISIFLSMQDEVETEEIIRDIFRQGKACFXXXXXXXXXXXXXXXXX
A0A673TBH1_MCL1-01      -----------WLLEVETWTQTSELPGSDKGVPGCRLACQGGGLPAHRSA
A0A673TBH1_MCL1-02      -----------WLLEVETWTQTSELPGSDKGSLL----------------
A0A673TBH1_MCL1-03      -----------FHVE--------DLEGGIRNVLLAFAGTGTPGSLASGSG
A0A673TBH1_MCL1-04      -----------FHVE--------DLEGGIRNVLLAFAGVAGVG---AGLA
A0A673UUI0_BCL2L1-      YGNN-------AAAESRKGQERFN------RWFLTGMTVAGVVLLGSLFS
A0A673VDM8_BCL2-01      YGPS-------M-------QPLFDFSWLSLKALLSLALVGACVTLGAYLG
                                                                          

A0A673TBH1_MCL1-05      R-------------------------------------------------
A0A673UC80_BCL2L10      LRRLS---------------------------------------------
A0A673VAY7_BCL2L2-      ASK-----------------------------------------------
A0A673TDC6_BCL2A1-      XXXXXXXXXXXXXXXXXTSHGFSDVTSHDFSDIIASRDFSDVITSHGFSD
A0A673TBH1_MCL1-01      HLYLLWLPPGSTHGPPHSQGRLRTVAGFLSHTQQSTVEEVMANSPTPLAA
A0A673TBH1_MCL1-02      --------------------------------------------------
A0A673TBH1_MCL1-03      DLDSDLRIAGVR--------------------------------------
A0A673TBH1_MCL1-04      YL--------IR--------------------------------------
A0A673UUI0_BCL2L1-      RK------------------------------------------------
A0A673VDM8_BCL2-01      HK------------------------------------------------
                                                                          

A0A673TBH1_MCL1-05      --------------------------------------------------
A0A673UC80_BCL2L10      --------------------------------------------------
A0A673VAY7_BCL2L2-      --------------------------------------------------
A0A673TDC6_BCL2A1-      IITSHDFSDVFTSHDFSDVITSQGFSDVITSHDFSDVFASHDFSDVMASH
A0A673TBH1_MCL1-01      PTPHGALRVGEPPRAWIRRHPPAPPVPGPLTQDLPQSLPGQLRDSVCWRA
A0A673TBH1_MCL1-02      --------------------------------------------------
A0A673TBH1_MCL1-03      --------------------------------------------------
A0A673TBH1_MCL1-04      --------------------------------------------------
A0A673UUI0_BCL2L1-      --------------------------------------------------
A0A673VDM8_BCL2-01      --------------------------------------------------
                                                                          

A0A673TBH1_MCL1-05      -----------------------------------
A0A673UC80_BCL2L10      -----------------------------------
A0A673VAY7_BCL2L2-      -----------------------------------
A0A673TDC6_BCL2A1-      GFSDVITSHGFSDVITYFPRSQ-------------
A0A673TBH1_MCL1-01      GWACGSGPQPLAQCLICFMDGGCTRDLIHEKASAD
A0A673TBH1_MCL1-02      -----------------------------------
A0A673TBH1_MCL1-03      -----------------------------------
A0A673TBH1_MCL1-04      -----------------------------------
A0A673UUI0_BCL2L1-      -----------------------------------
A0A673VDM8_BCL2-01      -----------------------------------
                                                           

© 1998-2021Legal notice