Dataset for protein BCL-2-like of organism Strigops habroptila

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*         .   *                                                                 
Ms------ysnryyVi----yklsq-g----a----ap--p--g------------aaaag---d--g---sp-p-p-p-
 fhpgrrgtlkfnl ykyvs-----r-ysws-leer--nr-gg-psppppsaapav-----vss-lv-ngv--s-h-a-l
 e      sdd ei lglnl cggspald aqg dpdelpt  dla  aaa  a gfw eetemahtll ga lwe   g
 a      aa  aa  dfih     k h       e  aa                     rae gl c a  h a   a

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
sa-a--aply------r--lq--hlgpaq---------------------------------------------------
--v-sp---wspqeylqyv--evgrrvqpdslpapppdalrqasleligrylreaageaepgakklfpgllggpgrpgga
phpvrhvavhlaede essep sedm  g                                                   
  a ng   a      dgc   p     a                                                   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       .  .**. .. .  : .  :  :  ::.:        .   *  . * **  ****::::: **. :  .  .
-----tvvrqtLRragdefsrryerafsqmlsqlhitpvtayqsf-vqVveelFrDGv-NWGRivtffsFGgvlcvesvs
adavmqrallv  qvassvqlqtrldlrpltrrielqsgevrkrvfrg mnhk s  nt    vmalit  alvtkklqn
     gk hha  ni  glmdkhq qgfsgd  kfadlg i ne aa   a           i e   fmh ke
     ad ae   e     ea      ad  d      e  a    ea                        a      d

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   :        :   :*  :      *:  :***:  *:  :                   :::         :   : 
--vqmt-vlvssiaywmTeylvshlreWiqsnGGWe-gFvdlygn-d-----rrs-------llsfat---vttlgayls
hgreqsgpekgrlvsii taitrsrhp lleq   dnr lmkfr-e-mrpsvdnvwetsnkwimtlvlvggillmfssvg
  k lr kcieq sgf   nnnkdn  dd      a  ef ev slegli kgq ifl t  agsk aacig  il f
  i  e e  d   a      id  a    a                aaaef f             g    aa   a a

       
....:..
       
------k
ymirey-
tlf  ry
     h 
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice