Dataset for protein BCL-2-like of organism Strigops habroptila

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A672TR23_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Strigops habroptila GN=BCL-2 (length=242 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPLPPGLSPPAAAAAAAVAAAAGTSSDHTGLVSPHPEPPGSAAA
SHAPLAEGLRPAPQVVHLTLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVM
CVESVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLG
HK
>gnl|bcl2dbpro|A0A672UHF9_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Strigops habroptila GN=BCL2A1 (length=174 residues).
METADFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDITSVAVAKRIFNGVMEEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIINNKAEWIDANGGWENGFLMKFERRSLLSFSKIT
AMFIAVFTLFREYY
>gnl|bcl2dbpro|A0A672UKR0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Strigops habroptila GN=BCL2L1 (length=230 residues).
MSSSNRALVIDFVSYKLSQKGHSWSQLEEEDENRTDFAAEEVEMDGVLNGSPSWHPPASHVVNGAAVHRSSLQVHDMVQA
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLV
GRIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEVRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A672UZL1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Strigops habroptila GN=MCL-1 (length=297 residues).
MFALKRNAVIGLNLYCGGSPALAPAPAAPGGGPAPPPPSAAPAGAWAAGRAEALLGCGAAPLPAPAPLPAPARPVPLWSP
EEELDGCEPEPERGPAGDSLPAPPPDALRQASLELIGRYLREAAGEAEPGAKKLFPGLLGGPGRPGGAADAVMGKALETL
RRVGDGVMAKHELAFQGMLRKLEIQKEEDLQSVREVAAHLFSDGVTNWGRVVTLISFGAFVAKHLKSIQQEKCISSLAGI
ITDALVSSRREWLLSQGGWEGFVDFFRVEDLEGSIRNVLMAFAGVAGLGASLAYMIR
© 1998-2020Legal notice