Dataset for protein BCL-2-like of organism Strigops habroptila

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A672UHF9_BCL2A1-      --METADFYYVYYLAQDYLQY-----------------------------
A0A672UZL1_MCL1-01      ------MFALKRNAVIGLNLYCGGSPALAPAPAAPGGGPAPPPPSAAPAG
A0A672TR23_BCL2-01      MAHPGRRGYDNREIVLKYIHY----------------------KLSQRGY
A0A672UKR0_BCL2L1-      ------MSSSNRALVIDFVSY----------------------KLSQKGH
                                      .     *                             

A0A672UHF9_BCL2A1-      --------------------------------------------------
A0A672UZL1_MCL1-01      AWAAGRAEALLGCGAAPLPAPAPLPAPARPVPLWSPEEELDGCEPEPERG
A0A672TR23_BCL2-01      DWAAGEDRAPLPPGLSP------------------PAAAAAAAVAAAAGT
A0A672UKR0_BCL2L1-      SWSQLEEEDENRTDFAA------------------EEVEMDGVLNG----
                                                                          

A0A672UHF9_BCL2A1-      -----VLQESHLGPAQTRVAH-----------------------------
A0A672UZL1_MCL1-01      PAGDS---LPAPPPDALRQASLELIGRYLREAAGEAEPGAKKLFPGLLGG
A0A672TR23_BCL2-01      SSDHTGLVSPHPEPPGSAAASHAPLAEGLRPAPQVVH-------------
A0A672UKR0_BCL2L1-      --------SPSWHPPASHVVNGAAVHRSSLQVHDMVQ-------------
                                 .   *     .                              

A0A672UHF9_BCL2A1-      -----------------VLRNIASSLQDQTEEALRPFLDRIDITSVAVAK
A0A672UZL1_MCL1-01      PGRPGGAADAVMGKALETLRRVGDGVMAKHELAFQGMLRKLEIQKEEDLQ
A0A672TR23_BCL2-01      -----------L-----TLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARG
A0A672UKR0_BCL2L1-      -----------AADVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQ
                                         .**  .. .  .    :  :  .: :       

A0A672UHF9_BCL2A1-      RIFNGVMEEKFADGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEQI
A0A672UZL1_MCL1-01      S-VREVAAHLFSDGVTNWGRVVTLISFGAFVAKHLKSIQQEKC---ISSL
A0A672TR23_BCL2-01      R-FVAVVEELFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPL---VDSI
A0A672UKR0_BCL2L1-      S-FEQVVNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMRVL---VGRI
                          .  *    * **  ****::::: **. :     .            :

A0A672UHF9_BCL2A1-      SYFITEYIINNKAEWIDANGGWENGFLMKFE-------------------
A0A672UZL1_MCL1-01      AGIITDALVSSRREWLLSQGGWE-GFVDFFRVEDLEGSIRNVLMAFA---
A0A672TR23_BCL2-01      AAWMTEYLNRHLHNWIQDNGGWD-AFVELYG-NSM-------RPLFDFSW
A0A672UKR0_BCL2L1-      VSWMTTYLTDHLDPWIQENGGWE-RFVDLYG-NDAAAEVRKGQETFN---
                           :*  :      *:  :***:  *:  :                    

A0A672UHF9_BCL2A1-      --RRSLLSFSKITAMFIAVFTLFREYY
A0A672UZL1_MCL1-01      -------------GVAGLGASLAYMIR
A0A672TR23_BCL2-01      ISLKTILSLVLVGACITLGAYLGHK--
A0A672UKR0_BCL2L1-      ---KWLLTGATVAGVLLLGSLLSRK--
                                     .       *     

© 1998-2020Legal notice