Dataset for protein BCL-2-like of organism Sphaeramia orbicularis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                   .         :          * : .                    .              
-----nre-v-f---yklsqrnypssv--mrrpqtrte-- rkan-g-----ttvangymantstg-----qvvvsl---
 mssq--- -v-y n---mkkgs  nllg ipepsdia   g mgl-lwqrvsamsedtlnlccp t pgs qrqrp   
  mh      e f c          ahi  cedda      d   c eeketl h   lf g       ag aaap    

        90       100       110       120       130       140       150       160
                               *   .  : .        :    :      .             ::  *
------------------------------- pstnvdsvklaaqdsanefelrytsaastllsqlhitpdt-yqsfrs 
                                stgdla mral r ved hqal arl qdfhr cgpe cs -- len 
                                  e                   q      n  d   a       k 

       170       180       190       200       210       220       230       240
:::                                  :. **  ****:..*.:* ..:.    :          :    
mde----------------------------------vvr  -v    ivg ft tgalavecveqkgtkpgldpqqmsp
                                       k  hl                rq m            evpg
                                       g                       a            d  e

       250       260       270       280       290       300       310    
    : : :: ** .    *: . ..*: * ::   .       .       : ..     .     *:     
lyrriadwmtv  dehisp iqsqgg es gki-gqdaaaekrssqesmkkwllagvvlvtavlvgv vaqkrl
n pglv t at  gnekqg  eea  r c   -- hh rg  qgstl ra f  mtvll gvtfs   k q 
  g       d      k            a          a   d  f       ag      i l       
© 1998-2021Legal notice