Dataset for protein BCL-2-like of organism Sphaeramia orbicularis

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A672YCF8_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Sphaeramia orbicularis GN=BCL2L10 (length=210 residues).
MKRGSPSAVLMCREQTDIAGRKMSCGLWKETLAMAEDYMALCCTGPQAAPPPPSESAAAMRLLAQDVERQHQARFLSLAQ
TFLRQCGPEPCSSLRKVMEELVGDGHLNWGRVVSLFTFTGVLARQLMEQKGTKPGLDPQQVPGNYRGLAETIADYLGEEK
KDWLLENDGWEGFCKFSHHARKVSQDSSMKKALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A672Z262_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Sphaeramia orbicularis GN=BCL2L1 (length=219 residues).
MSHSNRELVEFFICYKLSQKNYPSSLLRPDDARTEGDKANTTVSNGLLANSRNGGGQAVVSLPPSGDVDAVKAALQDSAD
EFELLYTQAFSGLSSQLDITPDTAYQSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECAEKDMSELVPRIADWMTTYLD
EHISPWIESAGGWDSFGEIFGQSAAAEARRSGETLKRWLLVGVVLLTGVLIGVLVAKKQ
>gnl|bcl2dbpro|A0A673A8P7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sphaeramia orbicularis GN=MCL-1 (length=294 residues).
MLIASLKLLIKMNIIPPSKRTAFGIMSVSLLHQNGVADPFGAEDSAQFIRDSAQFNRASALDSRNSNPQHRPNNLGVKAK
NEHLPKSLQEDRDEADADGSLPCTPEFQSLEPDVPSCPAGHEVLEADTRQLIIGFLKVFTGVSKPRWSQNEALSTMKRVV
EDLLEKHRYAYNGMINKLSLDDRGDDMRFVSAVATSLFEDGTTNWGRVASLVAFGAVVCQYLKKKGRENCVELVGEEISA
YLLSDQRDWLLKNNSWDGFVEFFRVSDPESTVRNTLMTVAGLAGIGATLAMLIR
>gnl|bcl2dbpro|A0A673A8P7_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sphaeramia orbicularis GN=MCL-1 (length=294 residues).
MLIASLKLLIKMNIIPPSKRTAFGIMSVSLLHQNGVADPFGAEDSAQFIRDSAQFNRASALDSRNSNPQHRPNNLGVKAK
NEHLPKSLQEDRDEADADGSLPCTPEFQSLEPDVPSCPAGHEVLEADTRQLIIGFLKVFTGVSKPRWSQNEALSTMKRVV
EDLLEKHRYAYNGMINKLSLDDRGDDMRFVSAVATSLFEDGTTNWGRVASLVAFGAVVCQYLKKKGRENCVELVGEEISA
YLLSDQRDWLLKNNSWDGFVEFFRVSDPESTVRNTLMTVAGLAGIGATLAMLIR
>gnl|bcl2dbpro|A0A673A8P7_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sphaeramia orbicularis GN=MCL-1 (length=294 residues).
MLIASLKLLIKMNIIPPSKRTAFGIMSVSLLHQNGVADPFGAEDSAQFIRDSAQFNRASALDSRNSNPQHRPNNLGVKAK
NEHLPKSLQEDRDEADADGSLPCTPEFQSLEPDVPSCPAGHEVLEADTRQLIIGFLKVFTGVSKPRWSQNEALSTMKRVV
EDLLEKHRYAYNGMINKLSLDDRGDDMRFVSAVATSLFEDGTTNWGRVASLVAFGAVVCQYLKKKGRENCVELVGEEISA
YLLSDQRDWLLKNNSWDGFVEFFRVSDPESTVRNTLMTVAGLAGIGATLAMLIR
>gnl|bcl2dbpro|A0A673A8P7_MCL1-04 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sphaeramia orbicularis GN=MCL-1 (length=294 residues).
MLIASLKLLIKMNIIPPSKRTAFGIMSVSLLHQNGVADPFGAEDSAQFIRDSAQFNRASALDSRNSNPQHRPNNLGVKAK
NEHLPKSLQEDRDEADADGSLPCTPEFQSLEPDVPSCPAGHEVLEADTRQLIIGFLKVFTGVSKPRWSQNEALSTMKRVV
EDLLEKHRYAYNGMINKLSLDDRGDDMRFVSAVATSLFEDGTTNWGRVASLVAFGAVVCQYLKKKGRENCVELVGEEISA
YLLSDQRDWLLKNNSWDGFVEFFRVSDPESTVRNTLMTVAGLAGIGATLAMLIR
>gnl|bcl2dbpro|A0A673BZP5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Sphaeramia orbicularis GN=BCL2L1 (length=231 residues).
MSQNRELVVFYINYKLSQRNYPINHIGLIEPPSRTDGGEAGLGEEQRVSTHANGTFNGTSPGTPPASPVRQRLPSTTNLD
SVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVG
RIVEWMTVYLDNHIQGWIQSQGGWERFAEIFGQDAAAEGRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
© 1998-2020Legal notice