Dataset for protein BCL-2-like of organism Sphaeramia orbicularis

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A673A8P7_MCL1-01      MLIASLKLLIKMNIIPPSKRTAFGIMSVSLLHQNGVADPFGAEDSAQFIR
A0A673A8P7_MCL1-02      MLIASLKLLIKMNIIPPSKRTAFGIMSVSLLHQNGVADPFGAEDSAQFIR
A0A673A8P7_MCL1-03      MLIASLKLLIKMNIIPPSKRTAFGIMSVSLLHQNGVADPFGAEDSAQFIR
A0A673A8P7_MCL1-04      MLIASLKLLIKMNIIPPSKRTAFGIMSVSLLHQNGVADPFGAEDSAQFIR
A0A672YCF8_BCL2L10      ------------------MKRGSPSAVL-MCREQTDIA--GRKMSCGLWK
A0A672Z262_BCL2L1-      -MSHSNRELVEFFICYKLSQKNYPSSL--LRPDDARTE--GDKAN-----
A0A673BZP5_BCL2L1-      --MSQNRELVVFYINYKLSQRNYPINHIGLIEPPSRTD--GGEAGLGEEQ
                                           .         :          * : .     

A0A673A8P7_MCL1-01      DSAQFNRASALDSRNSNPQHRPNNLGVKAKNEHLPKSLQEDRDEADADGS
A0A673A8P7_MCL1-02      DSAQFNRASALDSRNSNPQHRPNNLGVKAKNEHLPKSLQEDRDEADADGS
A0A673A8P7_MCL1-03      DSAQFNRASALDSRNSNPQHRPNNLGVKAKNEHLPKSLQEDRDEADADGS
A0A673A8P7_MCL1-04      DSAQFNRASALDSRNSNPQHRPNNLGVKAKNEHLPKSLQEDRDEADADGS
A0A672YCF8_BCL2L10      ETLAMAEDYMALCCTG-----PQAAPP-----------------------
A0A672Z262_BCL2L1-      --TTVSNGLLANSRNG---GGQAVVSL-----------------------
A0A673BZP5_BCL2L1-      RVSTHANGTFNGTSPGTPPASPVRQRL-----------------------
                                       .                                  

A0A673A8P7_MCL1-01      LPCTPEFQSLEPDVPSCPAGHEVLEADTRQLIIGFLKVFTGVSKP-RWSQ
A0A673A8P7_MCL1-02      LPCTPEFQSLEPDVPSCPAGHEVLEADTRQLIIGFLKVFTGVSKP-RWSQ
A0A673A8P7_MCL1-03      LPCTPEFQSLEPDVPSCPAGHEVLEADTRQLIIGFLKVFTGVSKP-RWSQ
A0A673A8P7_MCL1-04      LPCTPEFQSLEPDVPSCPAGHEVLEADTRQLIIGFLKVFTGVSKP-RWSQ
A0A672YCF8_BCL2L10      -----------PPSESAAAMRLLAQDVERQHQARFLSLAQTFLRQCGPEP
A0A672Z262_BCL2L1-      -----------PPSGDVDAVKAALQDSADEFELLYTQAFSGLSSQLDITP
A0A673BZP5_BCL2L1-      -----------PSTTNLDSVKEALRDSANEFELRYARAFSDLHNQLHITP
                                   *   .  : .        :    :      .        

A0A673A8P7_MCL1-01      NEALSTMKRVVEDLLEKHRYAYNGMINKLSLDDRGDDMRFVSAVATSLFE
A0A673A8P7_MCL1-02      NEALSTMKRVVEDLLEKHRYAYNGMINKLSLDDRGDDMRFVSAVATSLFE
A0A673A8P7_MCL1-03      NEALSTMKRVVEDLLEKHRYAYNGMINKLSLDDRGDDMRFVSAVATSLFE
A0A673A8P7_MCL1-04      NEALSTMKRVVEDLLEKHRYAYNGMINKLSLDDRGDDMRFVSAVATSLFE
A0A672YCF8_BCL2L10      CS---SLRKVMEE----------------------------------LVG
A0A672Z262_BCL2L1-      DTAYQSFKSVMDE----------------------------------VFK
A0A673BZP5_BCL2L1-      ATAYQSFENVMDE----------------------------------VFR
                             ::  *:::                                  :. 

A0A673A8P7_MCL1-01      DGTTNWGRVASLVAFGAVVCQYLKK----------KGRENCVELVGEEIS
A0A673A8P7_MCL1-02      DGTTNWGRVASLVAFGAVVCQYLKK----------KGRENCVELVGEEIS
A0A673A8P7_MCL1-03      DGTTNWGRVASLVAFGAVVCQYLKK----------KGRENCVELVGEEIS
A0A673A8P7_MCL1-04      DGTTNWGRVASLVAFGAVVCQYLKK----------KGRENCVELVGEEIS
A0A672YCF8_BCL2L10      DGHLNWGRVVSLFTFTGVLARQLMEQKGTKPGLDPQQVPGNYRGLAETIA
A0A672Z262_BCL2L1-      DG-VNWGRIVGLFAFGGVLCVECAE----------KDMSELVPRIADWMT
A0A673BZP5_BCL2L1-      DG-VNWGRIVGLFAFGGALCVECVE----------KEMSPLVGRIVEWMT
                        **  ****:..*.:* ..:.    :          :        : : ::

A0A673A8P7_MCL1-01      AYLLSDQRDWLLKNNSWDGFVEFFRVSDPESTVRN-----TLMTVAGLAG
A0A673A8P7_MCL1-02      AYLLSDQRDWLLKNNSWDGFVEFFRVSDPESTVRN-----TLMTVAGLAG
A0A673A8P7_MCL1-03      AYLLSDQRDWLLKNNSWDGFVEFFRVSDPESTVRN-----TLMTVAGLAG
A0A673A8P7_MCL1-04      AYLLSDQRDWLLKNNSWDGFVEFFRVSDPESTVRN-----TLMTVAGLAG
A0A672YCF8_BCL2L10      DYLGEEKKDWLLENDGWEGFCKF---SHHARKVSQDSSMKKALFAAAGVG
A0A672Z262_BCL2L1-      TYLDEHISPWIESAGGWDSFGEIFGQSAAAEARRSGETLKRWLLVGVVLL
A0A673BZP5_BCL2L1-      VYLDNHIQGWIQSQGGWERFAEIFGQDAAAEGRRSQESFKKWLLAGMTLV
                         ** .    *: . ..*: * ::   .       .       : ..    

A0A673A8P7_MCL1-01      IGATLAMLIR----
A0A673A8P7_MCL1-02      IGATLAMLIR----
A0A673A8P7_MCL1-03      IGATLAMLIR----
A0A673A8P7_MCL1-04      IGATLAMLIR----
A0A672YCF8_BCL2L10      LAGLTFLLVR----
A0A672Z262_BCL2L1-      TGVLIGVLVAKKQ-
A0A673BZP5_BCL2L1-      TGVVVGSLIAQKRL
                         .     *:     

© 1998-2020Legal notice