Dataset for protein BCL-2-like of organism Sparus aurata

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                :  :.   :     .                                  :     *        
------------msyfqngvvggtmhydsrdsapeiamsssldsqngnvgsndtpkrpinlgvntakaynvPkn------
mfpkkaaittgv-mssnrelavsylscklsqrnyplnl--------rt--------------ayssnngts g-lredse
             crq sdi erkin g wketlat hmrpieapg--eagktnsaatng ld ltlgcmq rt      
               e      ff             elgld  g   d daah          g fc g   p      
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                              :   : ::   .   : .*                               
-------pctpelqsendmdisscpagdellrqdtrqlisrflavytgLsk-----------------------------
dledgsl-p--p------------sevkaamddsaqefelqytrafsd htlrwkenkelstmmrvvegvlekhryayng
       a-ps- rqqrlpsttdle sa    cmsndm alhqqr hs aq                             
         a           a id          e      a       n                             
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    *          . .* ..:. **  ******.*::* ..:.    *:                      : : :: 
--kkLtlderedassvssVakslfaDGttNWGRVVsLmaFggvvsqylkEkgrghc--------------veqvgqeist
mvq- ritpptayqffrn mdevvr  -v      g ft taalcvecv qktsplglepgqelgqgpgncsriaewmtv
  tf hqcgddpch lkk i  k  hl               arq q  emkkp               rglidt am
     d   a      e       g                       m  dd e                g       d
                                                                                

       250       260       270       280       290       300       310  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
**    . *: .:..*: * : * . *   :            .*:      :                   
YLlteqrdWlvknnsWdgFve-FfrvAdpestvsntlmafagfaGigatlallig-----------------
  dehiqp iqsqgg es akv gqd aavarrrsetlsrwllv vtl--gvvvrvliarkrvhemtssspe
  gn kne  le   r c i s s re  qe rmskklfaa  ma-vt--ilsstvsqvqlcdlrl ra 
      k   e                       q kf k        lm   a prfllge          
                                                       l   k            
© 1998-2020Legal notice