Dataset for protein BCL-2-like of organism Sparus aurata

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A671VEU3_MCL1-02      MFPKKAAITTGVMSYFQNGVVGGTMHYDSRDSAPEIAMSSSLDSQNGNVG
A0A671VEU3_MCL1-03      MFPKKAAITTGVMSYFQNGVVGGTMHYDSRDSAPEIAMSSSLDSQNGNVG
A0A671VEU3_MCL1-01      MFPKKAAITTGVMSYFQNGVVGGTMHYDSRDSAPEIAMSSSLDSQNGNVG
A0A671XUH4_BCL2L10      ------------MCREQSDIAGRKMSCGLWKETLALAE------------
A0A0B4KJI5_BCL2L1-      ------------MSYSNRELVESFLSYKLSQRNYPTALLRPDDAGGRTEA
A0A671WXV0_BCL2L1-      -------------MSQNRELVVFYINYKLSQRNYPLNHMGLIESPNRTDG
                                        :  :.   :     .                   

A0A671VEU3_MCL1-02      SNDTPKRPINLGVNTAKAYNVPKNLREDSEDLEDGSLPCTPELQSENDMD
A0A671VEU3_MCL1-03      SNDTPKRPINLGVNTAKAYNVPKNLREDSEDLEDGSLPCTPELQSENDMD
A0A671VEU3_MCL1-01      SNDTPKRPINLGVNTAKAYNVPKNLREDSEDLEDGSLPCTPELQSENDMD
A0A671XUH4_BCL2L10      ------------DYLSLCCTSPRP-------------APPPP--------
A0A0B4KJI5_BCL2L1-      DKANSAATNGLLANSSNGGGQPG---------------------------
A0A671WXV0_BCL2L1-      GATH--------ANGTFNGMSPGT-------------PPASPLRQQRLPS
                                       :     *                            

A0A671VEU3_MCL1-02      ISSCPAGDELLDQDTRQLISRFLAVYTGLSKLRWKENKELSTMMRVVEGV
A0A671VEU3_MCL1-03      ISSCPAGDELLDQDTRQLISRFLAVYTGLSKLRWKENKELSTMMRVVEGV
A0A671VEU3_MCL1-01      ISSCPAGDELLDQDTRQLISRFLAVYTGLSKLRWKENKELSTMMRVVEGV
A0A671XUH4_BCL2L10      ----SESAAAMRCMAQDMEAQHQARFHSLAQ-------------------
A0A0B4KJI5_BCL2L1-      -ADIEAVKAALRDSSEEFELLFTQAFSDLST-------------------
A0A671WXV0_BCL2L1-      TTSLDAVKEALRDSANEFELRYARAFSDLHN-------------------
                                  :   : ::   .   : .*                     

A0A671VEU3_MCL1-02      LEKHRYAYNGMVKKLTLDEREDASFVSSVAKSLFADGTTNWGRVVSLMAF
A0A671VEU3_MCL1-03      LEKHRYAYNGMVKKLTLDEREDASFVSSVAKSLFADGTTNWGRVVSLMAF
A0A671VEU3_MCL1-01      LEKHRYAYNGMVKKLTLDEREDASFVSSVAKSLFADGTTNWGRVVSLMAF
A0A671XUH4_BCL2L10      ------------TFLRQCGPDPCSSLRKVIEELVGDGHLNWGRVVSLFTF
A0A0B4KJI5_BCL2L1-      ------------Q-LDITPDTAYHSFKSVMDEVFKDG-VNWGRVVGLFAF
A0A671WXV0_BCL2L1-      ------------Q-LHITPATAYQSFENVMDEVFRDG-VNWGRVVGLFAF
                                      *          . .* ..:. **  ******.*::*

A0A671VEU3_MCL1-02      GAVVSQYLKEKGRGHC--------------VEQVGQEISTYLLTEQRDWL
A0A671VEU3_MCL1-03      GAVVSQYLKEKGRGHC--------------VEQVGQEISTYLLTEQRDWL
A0A671VEU3_MCL1-01      GAVVSQYLKEKGRGHC--------------VEQVGQEISTYLLTEQRDWL
A0A671XUH4_BCL2L10      TGVLARQLQEQKDKKPGLEPGQELGQGPGNCRGLAETIADYLGEEKKEWL
A0A0B4KJI5_BCL2L1-      GGVLCVECVEKDTSEL--------------VSRIADWMTMYLDEHINPWI
A0A671WXV0_BCL2L1-      GGALCVECMEKEMSPL--------------VGRIIEWMTVYLDNHIQPWI
                         ..:.    *:                      : : :: **    . *:

A0A671VEU3_MCL1-02      VKNNSWDGFVE-FFRVADPESTVRNTLMAFAGFAGIGATLALLISPRVSR
A0A671VEU3_MCL1-03      VKNNSWDGFVE-FFRVADPESTVRNTLMAFAGFAGIGATLALLIR-----
A0A671VEU3_MCL1-01      VKNNSWDGFVE-FFRVADPESTVRNTLMAFAGFAGIGATLALLIR-----
A0A671XUH4_BCL2L10      LENDGWEGFCK-FSRSAREVSQESSMKKALFAAAGVG-----IAGLTFLL
A0A0B4KJI5_BCL2L1-      ESQGGWDSFAEVFGRDAAAEARRSRETLSRWLLVGVALLMGVVLGVLIAK
A0A671WXV0_BCL2L1-      QSQGGWERFAEIFGQDAAAESRRSQESFKKWLLAGMTLVTGVVVGSLIAQ
                         .:..*: * : * . *   :            .*:      :       

A0A671VEU3_MCL1-02      GEVHEMTSSSAE
A0A671VEU3_MCL1-03      ------------
A0A671VEU3_MCL1-01      ---CDLRLSRPE
A0A671XUH4_BCL2L10      VR----------
A0A0B4KJI5_BCL2L1-      KQ----------
A0A671WXV0_BCL2L1-      KRL---------
                                    

© 1998-2020Legal notice