Dataset for protein BCL-2-like of organism Sparus aurata

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A0B4KJI5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Sparus aurata GN=BCL2L1 (length=215 residues).
MSYSNRELVESFLSYKLSQRNYPTALLRPDDAGGRTEADKANSAATNGLLANSSNGGGQPGADIEAVKAALRDSSEEFEL
LFTQAFSDLSTQLDITPDTAYHSFKSVMDEVFKDGVNWGRVVGLFAFGGVLCVECVEKDTSELVSRIADWMTMYLDEHIN
PWIESQGGWDSFAEVFGRDAAAEARRSRETLSRWLLVGVALLMGVVLGVLIAKKQ
>gnl|bcl2dbpro|A0A671VEU3_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sparus aurata GN=MCL-1 (length=280 residues).
MFPKKAAITTGVMSYFQNGVVGGTMHYDSRDSAPEIAMSSSLDSQNGNVGSNDTPKRPINLGVNTAKAYNVPKNLREDSE
DLEDGSLPCTPELQSENDMDISSCPAGDELLDQDTRQLISRFLAVYTGLSKLRWKENKELSTMMRVVEGVLEKHRYAYNG
MVKKLTLDEREDASFVSSVAKSLFADGTTNWGRVVSLMAFGAVVSQYLKEKGRGHCVEQVGQEISTYLLTEQRDWLVKNN
SWDGFVEFFRVADPESTVRNTLMAFAGFAGIGATLALLIR
>gnl|bcl2dbpro|A0A671VEU3_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sparus aurata GN=MCL-1 (length=297 residues).
MFPKKAAITTGVMSYFQNGVVGGTMHYDSRDSAPEIAMSSSLDSQNGNVGSNDTPKRPINLGVNTAKAYNVPKNLREDSE
DLEDGSLPCTPELQSENDMDISSCPAGDELLDQDTRQLISRFLAVYTGLSKLRWKENKELSTMMRVVEGVLEKHRYAYNG
MVKKLTLDEREDASFVSSVAKSLFADGTTNWGRVVSLMAFGAVVSQYLKEKGRGHCVEQVGQEISTYLLTEQRDWLVKNN
SWDGFVEFFRVADPESTVRNTLMAFAGFAGIGATLALLISPRVSRGEVHEMTSSSAE
>gnl|bcl2dbpro|A0A671VEU3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sparus aurata GN=MCL-1 (length=289 residues).
MFPKKAAITTGVMSYFQNGVVGGTMHYDSRDSAPEIAMSSSLDSQNGNVGSNDTPKRPINLGVNTAKAYNVPKNLREDSE
DLEDGSLPCTPELQSENDMDISSCPAGDELLDQDTRQLISRFLAVYTGLSKLRWKENKELSTMMRVVEGVLEKHRYAYNG
MVKKLTLDEREDASFVSSVAKSLFADGTTNWGRVVSLMAFGAVVSQYLKEKGRGHCVEQVGQEISTYLLTEQRDWLVKNN
SWDGFVEFFRVADPESTVRNTLMAFAGFAGIGATLALLIRCDLRLSRPE
>gnl|bcl2dbpro|A0A671WXV0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Sparus aurata GN=BCL2L1 (length=222 residues).
MSQNRELVVFYINYKLSQRNYPLNHMGLIESPNRTDGGATHANGTFNGMSPGTPPASPLRQQRLPSTTSLDAVKEALRDS
ANEFELRYARAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECMEKEMSPLVGRIIEWMTVY
LDNHIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A671XUH4_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Sparus aurata GN=BCL2L10 (length=204 residues).
MCREQSDIAGRKMSCGLWKETLALAEDYLSLCCTSPRPAPPPPSESAAAMRCMAQDMEAQHQARFHSLAQTFLRQCGPDP
CSSLRKVIEELVGDGHLNWGRVVSLFTFTGVLARQLQEQKDKKPGLEPGQELGQGPGNCRGLAETIADYLGEEKKEWLLE
NDGWEGFCKFSRSAREVSQESSMKKALFAAAGVGIAGLTFLLVR
© 1998-2022Legal notice