Dataset for protein BCL-2-like of organism Sinocyclocheilus rhinocerous

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                                          * .   
mlkiqlriteinysltdihiensyfkylvrrtqemsyyhqelvvfmfkgskvqnekglw-iade--aartd-re nngea
                              maaavvllnrstalv--l-l-n--ddefdp----ta-----vas lgrkp
                                  n  dgahm tsyt-s-s-sv-----gligipglvwnssvn h  sv
                                         i  kprhrrrwlsmsywgvklskk y l nqig f  d 
                                            einfhngpkpgavie     a      l   e    
                                              a d  dil  a                       
                                                a    k                          

        90       100       110       120       130       140       150       160
        :              .                                                 .:     
lvmpekkpqrqstsnarq iv npgetdaeevhd-yt-  da emnnseiidahlksfsdlphskspysqlysv keagd
snt-- mme  eln-- -  s aa hg  ral -vl-r         q c ii rvnr  fslp-- rrrihr  n   e
   an gi    d s  r  a    gd    i kd-s                           hd nn   k       
       a                                                           kk   a       

       170       180       190       200       210       220       230       240
..   :.  :  :  .: :        .   :   :* *.  ***** .:. :*. :*    :      .  :   :: *
dllvrysqtyndllsqmhitpaaaymrvekfimdtl s dt-     igfvtl gal srcknlqreplagsiteqmtv 
sfvrl qle te ia  nfsqkgeqv  vat it v k       ca le   tm khqndrglmkq sn gde  e 
 iai   sd   k  i d npthr  tdc  k   g         a       m   qs     ash dl  k   d 
          h      i   l  l                          l           a      h     

       250       260       270       280       290       300  
*      *: .:                               .                  
 dnkiqp iqsqg--er-a-lygrqadsvsrksqeafkkwlglgmtllttvvvaslyaqkrl
 ngplrn  ek na da -aivskdrvaefpstwanvvtvtdv ilsvv-fti-a-l---  
 ltt eg   e    -- e - rqv gnggvpfsyst ssf q cg ig --- -yi     
  id                      a   hn   lm  lc a ad a  l    f-     
© 1998-2021Legal notice