Dataset for protein BCL-2-like of organism Sinocyclocheilus rhinocerous

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A673LV42_BCL2-01      ------------------------------MAQENVYDNRSIVVKYIHHK
A0A673M4N6_BCL2L1-      ----------------------------------MSYYHQELVVFFIKYK
A0A673IGS5_BCL2L1-      ----------------------------------MSYYHQELVVFFIKYK
A0A673M4N6_BCL2L1-      ----------------------------------MSYYHQELVVFFIKYK
A0A673HVU7_BCL2-01      -----------------------------------------MATEIRFDN
A0A673IXK8_MCL1-01      ---------------------------------------------MFPGS
A0A673MXF5_MCL1-01      ---------------------------------------------MFPGS
A0A673GSK0_MCL1-03      -------------------------------------------LSFNLRR
A0A673HSI2_MCL1-01      ---------------------------------------------MTLSL
A0A673GSK0_MCL1-01      MLKIQLRITEINYSLTDIHIENSYFKYLVRRTAAVSLLGAHTALVPAPAL
A0A673GSK0_MCL1-02      --------------------------------------------------
                                                                          

A0A673LV42_BCL2-01      LWKKGYVWE-------------VNGHDDSVSNG--LMMERREDG----GI
A0A673M4N6_BCL2L1-      LSQRNYPYNHIEFTEDTNRTDAAEGNDDEAAAGTTTLVNGSLNGTS-TGS
A0A673IGS5_BCL2L1-      LSQRNYPYNHIEFTEDTNRTDAAEGNDDEAAAGTTTLVNGSLNGTS-TGS
A0A673M4N6_BCL2L1-      LSQRNYPYNHIEFTEDTNRTDAAEGNDDEAAAGTTTLVNGSLNGTS-TGS
A0A673HVU7_BCL2-01      RNIVEKYINHKLSKKGYVWKSQSSGEDDD---TANKGIEGSSLNSGRRLQ
A0A673IXK8_MCL1-01      KVLNDKGFWPCIGITALNVNSSSGGLGRKPLVMPELKPQNQFTGNGLQGS
A0A673MXF5_MCL1-01      KVSNDSGFWPCIGIAALNVNNSSSGFGRKPLVMPELKAQNQFTGNGLQGS
A0A673GSK0_MCL1-03      SDRLEDELDGCADEPDAAVKPVRPGTNG----LKGLQLDGRFVCAA-DGS
A0A673HSI2_MCL1-01      GNRPMAALGVLADETDAALKPLRPGTNG----LKGLQLDGRFVSAG-DGS
A0A673GSK0_MCL1-01      KPRSEDELDGCADEPDAAVKPVRPGTNG----LKGLQLDGRFVCAA-DGS
A0A673GSK0_MCL1-02      ----------------------IPGTNG----LKGLQLDGRFVCAA-DGS
                                                * .           :           

A0A673LV42_BCL2-01      SPSSRHDPCRALHKVLSR--------------------------HDPCRA
A0A673M4N6_BCL2L1-      TGTPPRSPASTPQRQTNG--------------------------TGGLDA
A0A673IGS5_BCL2L1-      TGTPPRSPASTPQRQTNG--------------------------TGGLDA
A0A673M4N6_BCL2L1-      TGTPPRSPASTPQRQTNG--------------------------TGGLDA
A0A673HVU7_BCL2-01      APSAGGG------------------NNSECLIAHRVTRSD------PYSR
A0A673IXK8_MCL1-01      VPSSPEPDCEEVQDEYTSIYDALEMDTREIIDIFLKNFTGFPHSKSGNKQ
A0A673MXF5_MCL1-01      VPSSPETDCEEI-DDYTSIYAALEMDTREIIDAFLKSFTGLPHSKSGKNQ
A0A673GSK0_MCL1-03      LPNTPDP------QEFGS--AELDRDTRQLLLDFYRTHTGMCPQDRKQHH
A0A673HSI2_MCL1-01      LPATPDP------QELGS-------DTQQLLLDFYRTHTGMSLPDRKRHH
A0A673GSK0_MCL1-01      LPNTPDP------QEFGS--AELDRDTRQLLLDFYRTHTGMCPQDRKQHH
A0A673GSK0_MCL1-02      LPNTPDP------QEFGS--AELDRDTRQLLLDFYRTHTGMCPQDRKQHH
                           .                                              

A0A673LV42_BCL2-01      LHKVLREAGDELERLYQSDFAEMSKRLHLTSITAHQRFTA-VIDELFGDG
A0A673M4N6_BCL2L1-      VKEALRDSANEFELRYSQAFNDLSSQLHITPATAYQSFES-VMDEVFRDG
A0A673IGS5_BCL2L1-      VKEALRDSANEFELRYSQAFNDLSSQLHITPATAYQSFES-VMDEVFRDG
A0A673M4N6_BCL2L1-      VKEALRDSANEFELRYSQAFNDLSSQLHITPATAYQSFES-VMDEVFRDG
A0A673HVU7_BCL2-01      IYRALREAGDEIERLYQREFEEMSHRMIFSPNTTQRSFLA-VAEELFKDG
A0A673IXK8_MCL1-01      VLATMNRVVESLVVKHELAYKGMIARLNLEQKGEDVSFVKTVATELFSDG
A0A673MXF5_MCL1-01      VLSTMKRVVDSLAVKHELAYKGMIARLNLEQKGEDVSFVKTVATELFSDG
A0A673GSK0_MCL1-03      ALPTMTRVVADVLLKHETTFKGMLQRLQLESQADDMSFISFIAETMFRDD
A0A673HSI2_MCL1-01      ALPTMKRVVADVLIKHQITYTGMLQRLQLDSQPDDLSVIDCIAKTMFRDD
A0A673GSK0_MCL1-01      ALPTMTRVVADVLLKHETTFKGMLQRLQLESQADDMSFISFIAETMFRDD
A0A673GSK0_MCL1-02      ALPTMTRVVADVLLKHETTFKGMLQRLQLESQADDMSFISFIAETMFRDD
                           .:     ..   :.  :  :  .: :        .   :   :* *.

A0A673LV42_BCL2-01      V-NWGRIIAFFEFGGTVCVECVNKEMMAHVDNIAGWMTEYLNGPLHGWIQ
A0A673M4N6_BCL2L1-      V-NWGRIVGLFAFGGALCVECVEKEMSPLVGSIADWMTVYLDNKIQPWIQ
A0A673IGS5_BCL2L1-      V-NWGRIVGLFAFGGALCVECVEKEMSPLVGSIAEWMTVYLDNKIQPWIQ
A0A673M4N6_BCL2L1-      V-NWGRIVGLFAFGGALCVECVEKEMSPLVGSIADWMTVYLDNKIQPWIQ
A0A673HVU7_BCL2-01      V-NWGRIIAFFEFGGTMCVESVNREMASQVDNIAHWMTDYLNGPLENWIE
A0A673IXK8_MCL1-01      ITNWGRIASLLTLGAMVCKHQNDKGLSKCASLVGKEISSYLLITQRDWLL
A0A673MXF5_MCL1-01      ITNWGRICSLLTFGALVCKHQNDRGLSKCVSLVGEEISSYLLTDQRDWLL
A0A673GSK0_MCL1-03      TTNWGRIVSLVAFGAVVCSRLKELQRERCVETVTQQISSYLISEQHDWLL
A0A673HSI2_MCL1-01      TTNWGRIVSLVAFGAVVCSQLKELQRERCVETVAQQISSYLISEQHDWLL
A0A673GSK0_MCL1-01      TTNWGRIVSLVAFGAVVCSRLKELQRERCVETVTQQISSYLISEQHDWLL
A0A673GSK0_MCL1-02      TTNWGRIVSLVAFGAVVCSRLKELQRERCVETVTQQISSYLISEQHDWLL
                          ***** .:. :*. :*    :      .  :   :: **      *: 

A0A673LV42_BCL2-01      ENGGWEAFVELYGRQRDSVFRSSWSSIVTVFGLAALGAVGLTIGAYLAQK
A0A673M4N6_BCL2L1-      SQGGW------VGRVAGNGGVLVQSAF-SLCDQGCDLIG-----------
A0A673IGS5_BCL2L1-      SQGGWERFAEIFGKDAAAESRKSQENFKKWLLVGMTLLTGVVVGSLIAQK
A0A673M4N6_BCL2L1-      SQGGWERFAEIFGKDAVAESRKSQENFKKWLLAGMTLLTGVVVGSLIAQK
A0A673HVU7_BCL2-01      ENGGWDAFVELYSQQRDSVFHPFSYLT-KVLGLAVLGLAGVTIGAFFAQK
A0A673IXK8_MCL1-01      KNNAWDGFVEFFH------VPNTEAAV-RNTLMAIGSVATFGAALAYLIR
A0A673MXF5_MCL1-01      KNKAWDGFVAFFH------VPDTEAAM-RNTLMAIGGVATFGAALAYLIR
A0A673GSK0_MCL1-03      NNK--HGFVEFFH------VEDVESVI-RNALMAVVGCAGIGAGLAFLIR
A0A673HSI2_MCL1-01      NNKGWHGFEEFFR------VEDVESVV-RSALMAVVGCAGIGAGLALLIR
A0A673GSK0_MCL1-01      NNK--HGFVEFFH------VEDVESVI-RNALMAVVGCAGIGAGLAFLIR
A0A673GSK0_MCL1-02      NNK--HGFVEFFH------VEDVESVI-RNALMAVVGCAGIGAGLAFLIR
                        .:                               .                

A0A673LV42_BCL2-01      --
A0A673M4N6_BCL2L1-      --
A0A673IGS5_BCL2L1-      RL
A0A673M4N6_BCL2L1-      RL
A0A673HVU7_BCL2-01      --
A0A673IXK8_MCL1-01      --
A0A673MXF5_MCL1-01      --
A0A673GSK0_MCL1-03      --
A0A673HSI2_MCL1-01      --
A0A673GSK0_MCL1-01      --
A0A673GSK0_MCL1-02      --
                          

© 1998-2020Legal notice