Dataset for protein BCL-2-like of organism Sinocyclocheilus rhinocerous

[Download (right click)] [Alignment] [Repertoires]

11 sequence(s)

>gnl|bcl2dbpro|A0A673GSK0_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=MCL-1 (length=278 residues).
MLKIQLRITEINYSLTDIHIENSYFKYLVRRTAAVSLLGAHTALVPAPALKPRSEDELDGCADEPDAAVKPVRPGTNGLK
GLQLDGRFVCAADGSLPNTPDPQEFGSAELDRDTRQLLLDFYRTHTGMCPQDRKQHHALPTMTRVVADVLLKHETTFKGM
LQRLQLESQADDMSFISFIAETMFRDDTTNWGRIVSLVAFGAVVCSRLKELQRERCVETVTQQISSYLISEQHDWLLNNK
HGFVEFFHVEDVESVIRNALMAVVGCAGIGAGLAFLIR
>gnl|bcl2dbpro|A0A673GSK0_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=MCL-1 (length=206 residues).
IPGTNGLKGLQLDGRFVCAADGSLPNTPDPQEFGSAELDRDTRQLLLDFYRTHTGMCPQDRKQHHALPTMTRVVADVLLK
HETTFKGMLQRLQLESQADDMSFISFIAETMFRDDTTNWGRIVSLVAFGAVVCSRLKELQRERCVETVTQQISSYLISEQ
HDWLLNNKHGFVEFFHVEDVESVIRNALMAVVGCAGIGAGLAFLIR
>gnl|bcl2dbpro|A0A673GSK0_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=MCL-1 (length=235 residues).
LSFNLRRSDRLEDELDGCADEPDAAVKPVRPGTNGLKGLQLDGRFVCAADGSLPNTPDPQEFGSAELDRDTRQLLLDFYR
THTGMCPQDRKQHHALPTMTRVVADVLLKHETTFKGMLQRLQLESQADDMSFISFIAETMFRDDTTNWGRIVSLVAFGAV
VCSRLKELQRERCVETVTQQISSYLISEQHDWLLNNKHGFVEFFHVEDVESVIRNALMAVVGCAGIGAGLAFLIR
>gnl|bcl2dbpro|A0A673HSI2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=MCL-1 (length=230 residues).
MTLSLGNRPMAALGVLADETDAALKPLRPGTNGLKGLQLDGRFVSAGDGSLPATPDPQELGSDTQQLLLDFYRTHTGMSL
PDRKRHHALPTMKRVVADVLIKHQITYTGMLQRLQLDSQPDDLSVIDCIAKTMFRDDTTNWGRIVSLVAFGAVVCSQLKE
LQRERCVETVAQQISSYLISEQHDWLLNNKGWHGFEEFFRVEDVESVVRSALMAVVGCAGIGAGLALLIR
>gnl|bcl2dbpro|A0A673HVU7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BCL-2 (length=229 residues).
MATEIRFDNRNIVEKYINHKLSKKGYVWKSQSSGEDDDTANKGIEGSSLNSGRRLQAPSAGGGNNSECLIAHRVTRSDPY
SRIYRALREAGDEIERLYQREFEEMSHRMIFSPNTTQRSFLAVAEELFKDGVNWGRIIAFFEFGGTMCVESVNREMASQV
DNIAHWMTDYLNGPLENWIEENGGWDAFVELYSQQRDSVFHPFSYLTKVLGLAVLGLAGVTIGAFFAQK
>gnl|bcl2dbpro|A0A673IGS5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BCL2L1 (length=239 residues).
MSYYHQELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGNDDEAAAGTTTLVNGSLNGTSTGSTGTPPRSPASTPQRQ
TNGTGGLDAVKEALRDSANEFELRYSQAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVE
KEMSPLVGSIAEWMTVYLDNKIQPWIQSQGGWERFAEIFGKDAAAESRKSQENFKKWLLVGMTLLTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A673IXK8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=MCL-1 (length=248 residues).
MFPGSKVLNDKGFWPCIGITALNVNSSSGGLGRKPLVMPELKPQNQFTGNGLQGSVPSSPEPDCEEVQDEYTSIYDALEM
DTREIIDIFLKNFTGFPHSKSGNKQVLATMNRVVESLVVKHELAYKGMIARLNLEQKGEDVSFVKTVATELFSDGITNWG
RIASLLTLGAMVCKHQNDKGLSKCASLVGKEISSYLLITQRDWLLKNNAWDGFVEFFHVPNTEAAVRNTLMAIGSVATFG
AALAYLIR
>gnl|bcl2dbpro|A0A673LV42_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BCL-2 (length=223 residues).
MAQENVYDNRSIVVKYIHHKLWKKGYVWEVNGHDDSVSNGLMMERREDGGISPSSRHDPCRALHKVLSRHDPCRALHKVL
REAGDELERLYQSDFAEMSKRLHLTSITAHQRFTAVIDELFGDGVNWGRIIAFFEFGGTVCVECVNKEMMAHVDNIAGWM
TEYLNGPLHGWIQENGGWEAFVELYGRQRDSVFRSSWSSIVTVFGLAALGAVGLTIGAYLAQK
>gnl|bcl2dbpro|A0A673M4N6_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BCL2L1 (length=219 residues).
MSYYHQELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGNDDEAAAGTTTLVNGSLNGTSTGSTGTPPRSPASTPQRQ
TNGTGGLDAVKEALRDSANEFELRYSQAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVE
KEMSPLVGSIADWMTVYLDNKIQPWIQSQGGWVGRVAGNGGVLVQSAFSLCDQGCDLIG
>gnl|bcl2dbpro|A0A673M4N6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BCL2L1 (length=239 residues).
MSYYHQELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGNDDEAAAGTTTLVNGSLNGTSTGSTGTPPRSPASTPQRQ
TNGTGGLDAVKEALRDSANEFELRYSQAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVE
KEMSPLVGSIADWMTVYLDNKIQPWIQSQGGWERFAEIFGKDAVAESRKSQENFKKWLLAGMTLLTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A673MXF5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=MCL-1 (length=247 residues).
MFPGSKVSNDSGFWPCIGIAALNVNNSSSGFGRKPLVMPELKAQNQFTGNGLQGSVPSSPETDCEEIDDYTSIYAALEMD
TREIIDAFLKSFTGLPHSKSGKNQVLSTMKRVVDSLAVKHELAYKGMIARLNLEQKGEDVSFVKTVATELFSDGITNWGR
ICSLLTFGALVCKHQNDRGLSKCVSLVGEEISSYLLTDQRDWLLKNKAWDGFVAFFHVPDTEAAMRNTLMAIGGVATFGA
ALAYLIR
© 1998-2020Legal notice