Dataset for protein Mcl-1 of organism Sinocyclocheilus grahami

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
           egea vllkttrvssavyvrsvtqhaar-xxxxxxxxxxxxxxxxvsaad slptt dpq lgsa i  
                  qhpsnmrgglslknc   n    f           a                  t       
                     a l   faga     i                                           

        90       100       110       120       130       140       150       160
                                                          *: **:*:.: :*:**:  :* 
eytsiyda------------------------------a-vt---advlm---i---- ia  n dqkad m  igci e
d     a  dr   qllld yrtr  mcprdrklhha -d--tia-----cly-fsa           p  l       k
                  a   sf  l     ekt   s dp   drisa                              
                                         k      a                               

       170       180       190       200       210       220       230       240
 :* *. *****: **::***:**.. ::    .**. *.: *****:: *.****:*:.* *** **.* : *:.:*.:
ev n ni     va  lt   m  krlkdkglsk  el akq     ist h    k na d   a  h env aai sa
 l r d       c           q   r  g       el       e                      m  tm   

       250       260       270       280       290       300       310       320
***: . * :**.** :**                                                             
   igsc gf  a  fm  ssvgsnedygndthraspdppahccntccgylsqaahgcytqwntskamrqymssqvkspf

© 1998-2021Legal notice