Dataset for protein Mcl-1 of organism Sinocyclocheilus grahami

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A672K136_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus grahami GN=MCL-1 (length=121 residues).
MLQRLQLESQADDMSFIGCIAETMFNDNTTNWGRIVSLVAFGAVVCSRLKELQRERCVETVAQQISSYLISDQHDWLLNN
KGWHGFVEFFRVEDVESVIRNALMAVVGCAGIGAGLAFLIR
>gnl|bcl2dbpro|A0A672KAT0_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus grahami GN=MCL-1 (length=141 residues).
PDDPTIAARISACLYIFSAGMLQRLQLDSQPDDLSFIGCIAKTMFRDDTTNWGRVVSLVAFGAVVCSQLKELQRERCVET
VAQLISSYLISEQHDWLLNNKGWHGFVAFFRVEDMESVVRSALMAVVGCAGIGAGLALLIR
>gnl|bcl2dbpro|A0A672KMK1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus grahami GN=MCL-1 (length=247 residues).
MFPGSKVSNDSGFWPCIGIAALNVNNSSSGFGRKPLVMPELKAQNQFTGNGLQGSVPSSPETDCEEIDDYTSIYAALEMD
TREIIDAFLKSFTGLPHSKSEKTQVLSTMKRVVDSLAVKHELAYKGMIARLNLEQKGEDVSFVKTVATELFSDGITNWGR
ICSLLTFGAMVCKHQNDRGLGKCVSLVGEEISSYLLTDQRDWLLKNKAWDGFVEFFHVPDTEATMRNTLMAIGGVATFGA
ALAYMIR
>gnl|bcl2dbpro|A0A672PT04_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus grahami GN=MCL-1 (length=248 residues).
MSLSPALPRESEGEASVLSHTTNLSSALALTACTQHAARSXXXXXXXXXXXXXXXXVSAADGSLPSTPDPQELGSAELDR
DTRQLLLDFYRTRTGMCPRDRKLHHALPTVTRVVADVLVKHEIAYKGMLQRLQLESQADDMSFIGCIAETMFNDNTTNWG
RIVSLVAFGAVVCSRLKELQRERCVETVAQQISSYLISDQHDWLLNNKGWHGFVEFFRVEDVESVIRNALMAVVGCAGIG
AGLAFLIR
>gnl|bcl2dbpro|A0A672PT04_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus grahami GN=MCL-1 (length=206 residues).
VQKPARVRGGVSGKSVTQHAARSTTPDPQELGSAELDRDTRQLLLDFYRTRTGMCPRDRKLHHALPTVTRVVADVLVKHE
IAYKGMLQRLQLESQADDMSFIGCIAETMFNDNTTNWGRIVSLVAFGAVVCSRLKELQRERCVETVAQQISSYLISDQHD
WLLNNKGWHGFVEFFRVEDVESVIRNALMAVVGCAGIGAGLAFLIR
>gnl|bcl2dbpro|A0A672RP45_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus grahami GN=MCL-1 (length=248 residues).
MFPGSKVLNDKGFWPCIGITALNVNSSSGGLGRKPLVMPELKPQNQFTGNGLQGSVPSSPEPDCEEVQDEYTSIYDALEM
DTREIIDIFLKNVTGFPHSKSGNKQVLATMNRVVESLVMKHELAYKGMIARLNLEQKGEDVSFVKTVATEVFSDGITNWG
RIASLLAFGAVVCKHQNDKGLSKCVSLVGKEISSYLLTTQRDWLLKNNAWDGFVEFFHVPNTEAAVRNTLMAIGSVATFG
AALAYLIR
>gnl|bcl2dbpro|A0A672RP45_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus grahami GN=MCL-1 (length=233 residues).
MWSAFYVRNLISSGGLGRKPLVMPELKPQNQFTGNGLQGSVPSSPEPDCEEVQDEYTSIYDALEMDTREIIDIFLKNVTG
FPHSKSGNKQVLATMNRVVESLVMKHELAYKGMIARLNLEQKGEDVSFVKTVATEVFSDGITNWGRIASLLAFGAVVCKH
QNDKGLSKCVSLVGKEISSYLLTTQRDWLLKNNAWDGFVEFFHVPNTEAAVRNTLMAIGSVATFGAALAYLIR
>gnl|bcl2dbpro|A0A672RP45_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sinocyclocheilus grahami GN=MCL-1 (length=310 residues).
MFPGSKVLNDKGFWPCIGITALNVNSSSGGLGRKPLVMPELKPQNQFTGNGLQGSVPSSPEPDCEEVQDEYTSIYDALEM
DTREIIDIFLKNVTGFPHSKSGNKQVLATMNRVVESLVMKHELAYKGMIARLNLEQKGEDVSFVKTVATEVFSDGITNWG
RIASLLAFGAVVCKHQNDKGLSKCVSLVGKEISSYLLTTQRDWLLKNNAWDGFVEFFHVPNTEAAVRNTLMAIGSVATFG
AALAYLIRSSVGSNEDYGNDTHRASPDPPAHCCNTCCGYLSQAAHGCYTQWNTSKAMRQYMSSQVKSPFI
© 1998-2020Legal notice