Dataset for protein Mcl-1 of organism Sinocyclocheilus grahami

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A672K136_MCL1-01      --------------------------------------------------
A0A672KAT0_MCL1-01      --------------------------------------------------
A0A672KMK1_MCL1-01      -----------MFPGSKVSNDSGFWPCIGIAALNVNNSSSGFGRKPLVMP
A0A672RP45_MCL1-02      -----------------------MWSAFYVRNL---ISSGGLGRKPLVMP
A0A672RP45_MCL1-01      -----------MFPGSKVLNDKGFWPCIGITALNVNSSSGGLGRKPLVMP
A0A672RP45_MCL1-03      -----------MFPGSKVLNDKGFWPCIGITALNVNSSSGGLGRKPLVMP
A0A672PT04_MCL1-01      MSLSPALPRESEGEASVLSHTTNLSSALALTACTQHAARSXXXXXXXXXX
A0A672PT04_MCL1-02      -----------------VQKPARVRGGVSGKSVTQHAARS----------
                                                                          

A0A672K136_MCL1-01      --------------------------------------------------
A0A672KAT0_MCL1-01      --------------------------------------------------
A0A672KMK1_MCL1-01      ELKAQNQFTGNGLQGSVPSSPETDCEEI-DDYTSIYAALEMDTREIIDAF
A0A672RP45_MCL1-02      ELKPQNQFTGNGLQGSVPSSPEPDCEEVQDEYTSIYDALEMDTREIIDIF
A0A672RP45_MCL1-01      ELKPQNQFTGNGLQGSVPSSPEPDCEEVQDEYTSIYDALEMDTREIIDIF
A0A672RP45_MCL1-03      ELKPQNQFTGNGLQGSVPSSPEPDCEEVQDEYTSIYDALEMDTREIIDIF
A0A672PT04_MCL1-01      XXXXXXVSAADGSLPSTPDPQELGSAE-----------LDRDTRQLLLDF
A0A672PT04_MCL1-02      ---------------TTPDPQELGSAE-----------LDRDTRQLLLDF
                                                                          

A0A672K136_MCL1-01      --------------------------------------MLQRLQLESQAD
A0A672KAT0_MCL1-01      ------------------PDDPTIAARISACLYIFSAGMLQRLQLDSQPD
A0A672KMK1_MCL1-01      LKSFTGLPHSKSEKTQVLSTMKRVVDSLAVKHELAYKGMIARLNLEQKGE
A0A672RP45_MCL1-02      LKNVTGFPHSKSGNKQVLATMNRVVESLVMKHELAYKGMIARLNLEQKGE
A0A672RP45_MCL1-01      LKNVTGFPHSKSGNKQVLATMNRVVESLVMKHELAYKGMIARLNLEQKGE
A0A672RP45_MCL1-03      LKNVTGFPHSKSGNKQVLATMNRVVESLVMKHELAYKGMIARLNLEQKGE
A0A672PT04_MCL1-01      YRTRTGMCPRDRKLHHALPTVTRVVADVLVKHEIAYKGMLQRLQLESQAD
A0A672PT04_MCL1-02      YRTRTGMCPRDRKLHHALPTVTRVVADVLVKHEIAYKGMLQRLQLESQAD
                                                              *: **:*:.: :

A0A672K136_MCL1-01      DMSFIGCIAETMFNDNTTNWGRIVSLVAFGAVVCSRLKELQRERCVETVA
A0A672KAT0_MCL1-01      DLSFIGCIAKTMFRDDTTNWGRVVSLVAFGAVVCSQLKELQRERCVETVA
A0A672KMK1_MCL1-01      DVSFVKTVATELFSDGITNWGRICSLLTFGAMVCKHQNDRGLGKCVSLVG
A0A672RP45_MCL1-02      DVSFVKTVATEVFSDGITNWGRIASLLAFGAVVCKHQNDKGLSKCVSLVG
A0A672RP45_MCL1-01      DVSFVKTVATEVFSDGITNWGRIASLLAFGAVVCKHQNDKGLSKCVSLVG
A0A672RP45_MCL1-03      DVSFVKTVATEVFSDGITNWGRIASLLAFGAVVCKHQNDKGLSKCVSLVG
A0A672PT04_MCL1-01      DMSFIGCIAETMFNDNTTNWGRIVSLVAFGAVVCSRLKELQRERCVETVA
A0A672PT04_MCL1-02      DMSFIGCIAETMFNDNTTNWGRIVSLVAFGAVVCSRLKELQRERCVETVA
                        *:**:  :*  :* *. *****: **::***:**.. ::    .**. *.

A0A672K136_MCL1-01      QQISSYLISDQHDWLLNNKGWHGFVEFFRVEDVESVIRNALMAVVGCAGI
A0A672KAT0_MCL1-01      QLISSYLISEQHDWLLNNKGWHGFVAFFRVEDMESVVRSALMAVVGCAGI
A0A672KMK1_MCL1-01      EEISSYLLTDQRDWLLKNKAWDGFVEFFHVPDTEATMRNTLMAIGGVATF
A0A672RP45_MCL1-02      KEISSYLLTTQRDWLLKNNAWDGFVEFFHVPNTEAAVRNTLMAIGSVATF
A0A672RP45_MCL1-01      KEISSYLLTTQRDWLLKNNAWDGFVEFFHVPNTEAAVRNTLMAIGSVATF
A0A672RP45_MCL1-03      KEISSYLLTTQRDWLLKNNAWDGFVEFFHVPNTEAAVRNTLMAIGSVATF
A0A672PT04_MCL1-01      QQISSYLISDQHDWLLNNKGWHGFVEFFRVEDVESVIRNALMAVVGCAGI
A0A672PT04_MCL1-02      QQISSYLISDQHDWLLNNKGWHGFVEFFRVEDVESVIRNALMAVVGCAGI
                        : *****:: *.****:*:.* *** **.* : *:.:*.:***: . * :

A0A672K136_MCL1-01      GAGLAFLIR-----------------------------------------
A0A672KAT0_MCL1-01      GAGLALLIR-----------------------------------------
A0A672KMK1_MCL1-01      GAALAYMIR-----------------------------------------
A0A672RP45_MCL1-02      GAALAYLIR-----------------------------------------
A0A672RP45_MCL1-01      GAALAYLIR-----------------------------------------
A0A672RP45_MCL1-03      GAALAYLIRSSVGSNEDYGNDTHRASPDPPAHCCNTCCGYLSQAAHGCYT
A0A672PT04_MCL1-01      GAGLAFLIR-----------------------------------------
A0A672PT04_MCL1-02      GAGLAFLIR-----------------------------------------
                        **.** :**                                         

A0A672K136_MCL1-01      ---------------------
A0A672KAT0_MCL1-01      ---------------------
A0A672KMK1_MCL1-01      ---------------------
A0A672RP45_MCL1-02      ---------------------
A0A672RP45_MCL1-01      ---------------------
A0A672RP45_MCL1-03      QWNTSKAMRQYMSSQVKSPFI
A0A672PT04_MCL1-01      ---------------------
A0A672PT04_MCL1-02      ---------------------
                                             

© 1998-2020Legal notice