Dataset for protein Bcl-xL of organism Sinocyclocheilus grahami

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************* *** *.****************************
MSYYNRELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGNDDEeAAGtTtLVNGSLNGTSTGSTGTPPRSPASTPQRQ
                                             a   m n                            

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
TNGTGGLDAVKEALRDSANEFELRYSQAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVE
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***********:*******************                         *: . : :: .  *.  * . *: 
KEMSPLVGSIAeWMTVYLDNKIQPWIQSQGG-------------------------WvsgkmtvltsyvVsslIksyRl-
           d                   werfaeifgkdaaaesrksqenfkk llaglllffgvp glk aqk fg

  
..
  
--
tt
© 1998-2020Legal notice