Dataset for protein Bcl-xL of organism Sinocyclocheilus grahami

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A672K8R2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Sinocyclocheilus grahami GN=BCL2L1 (length=217 residues).
MSYYNRELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGNDDEAAAGMTNLVNGSLNGTSTGSTGTPPRSPASTPQRQ
TNGTGGLDAVKEALRDSANEFELRYSQAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVE
KEMSPLVGSIAEWMTVYLDNKIQPWIQSQGGWVSGKLLVFFSYPVSLKIKSYRFGTT
>gnl|bcl2dbpro|A0A672N8N5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Sinocyclocheilus grahami GN=BCL2L1 (length=239 residues).
MSYYNRELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGNDDEEAAGTTTLVNGSLNGTSTGSTGTPPRSPASTPQRQ
TNGTGGLDAVKEALRDSANEFELRYSQAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVE
KEMSPLVGSIADWMTVYLDNKIQPWIQSQGGWERFAEIFGKDAAAESRKSQENFKKWLLAGMTLLTGVVVGSLIAQKRL
© 1998-2020Legal notice