Dataset for protein Bcl-xL of organism Sinocyclocheilus grahami

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A672K8R2_BCL2L1-      MSYYNRELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGNDDEAAAGM
A0A672N8N5_BCL2L1-      MSYYNRELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGNDDEEAAGT
                        ********************************************* *** 

A0A672K8R2_BCL2L1-      TNLVNGSLNGTSTGSTGTPPRSPASTPQRQTNGTGGLDAVKEALRDSANE
A0A672N8N5_BCL2L1-      TTLVNGSLNGTSTGSTGTPPRSPASTPQRQTNGTGGLDAVKEALRDSANE
                        *.************************************************

A0A672K8R2_BCL2L1-      FELRYSQAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAF
A0A672N8N5_BCL2L1-      FELRYSQAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAF
                        **************************************************

A0A672K8R2_BCL2L1-      GGALCVECVEKEMSPLVGSIAEWMTVYLDNKIQPWIQSQGG---------
A0A672N8N5_BCL2L1-      GGALCVECVEKEMSPLVGSIADWMTVYLDNKIQPWIQSQGGWERFAEIFG
                        *********************:*******************         

A0A672K8R2_BCL2L1-      ----------------WVSGKLLVFFSYPVSLKIKSYRFGTT
A0A672N8N5_BCL2L1-      KDAAAESRKSQENFKKWLLAGMTLLTGVVVGSLIAQKRL---
                                        *: . : :: .  *.  * . *:   

© 1998-2020Legal notice