Dataset for protein BCL-2-like of organism Salmo salar

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     .       :  :        .:                                                     
mmtynn----rtivekyinhkllqrgypw---------------------------------------------------
-ansdsptratftivyfqtyvvskssfvaddgtplcyfqggetvcagaspkskvdtdlgngtgdtpprptklgvnvvksn
v-mnl fyns elmln  hg--ggmd af  ar  y    agai                          t         
 sads i    c   h  c-r  nkn sc                                                   
 ks e          f  s        l                                                    
  l                                                                             
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          .                                     .            .            :     
-lfnhlsdrsnrdegg-slpctpqvasrcggelnngpsgdpplqhrtsq------------pdphaglhrv---lrdavd
vnhegmeeapgntdsds-ispsagmfterspassgcvgtvevresdprslienllgdyiglsqrrwrqskalttmtrvgn
gdgqpetgsesdgnn-qm-eng-el-r--nqpnaatsds-ssysnplp     f    t  tpgt-kidapkea kesak
 kqmnan eqdaaf-ep v-g-la-tayvhatapese--trhnpkws               r -mamep  a      g
 edle         v g t -r - l-hpd it  r pns   laki                   t            e
 c id             p  p                                                          
    a             a                                                             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:.   :   :                 .   :   :* **  ****: .:. **..:.    :      :  :   :  *
eierryqrafaemssqLhltpstayrsFenvi-delFrDGv-NWGRivalfaFGgtvcvecvekemtsqvdriaqwmteY
dfilkhaydysdl-hk-yidsr-ddqrvtesmaktv s  tt    vasfve  avlsqrlknrgrgplielvgdniat 
 l am tp  ng-vg- -f-das-qmg ramv - m         ig  s   am  hs dmd shc gn tve mv 
 v il r    - ia  e- --m elf is   e                      i         nt  ah  r   k 
              -  d    c  h  lg                                            h     
                                                                          g     
                                                                                

       250       260       270       280       290       300        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
* .    *: .:. *: *.*::         .              :        .  :.  :     
LngplqpWiqenggWdaFvEifg------srrr-s-f-swp--ktvlglaalgaagvtigalitqk--
 lshqrd lvsqna nr a fyhvqdpes-vqsq-v-k---ll-mlf------gtsavvamyfr--rl
 dndiss  ik  d eg   drdaaaevqkniesihk lyigatiaf gfavl lll sflak  q
     ln               em    d    d n c   sa vi     v ls  i   m    
     h                 k             i    v           i        i    
                                                                    
                                                                    
© 1998-2022Legal notice