Dataset for protein BCL-2-like of organism Salmo salar

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A1S3LY44_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Salmo salar GN=BCL-2 (length=226 residues).
MANDDNRCIVEKYICHKLLKRGYAWDFENAEDEEDADNNGSMISPPPGLARRCHGANNARPGSVPHLSKRLSQTDPHAAI
HRVLREAGDELERLYQPDFAEMSHQLYLTSSMAERRFREVIDELFRDGVNWGRIVAFFEFGGTICVECVNKEMTSQVDHI
AGWMTEYLNGPLHSWIQENGGWEAFVELYDRQRDSVFCSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A1S3MED7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Salmo salar GN=BCL2L1 (length=230 residues).
MTYNNRELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGGQAEGGAAVTTHPNGAANGTSPGTPPRQSPPSSPQRTMGLDA
VKEALRDSANEFELRYARAFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSPLVGR
IADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAAAESRKSQENFKKWLLAGMTLVTGVIVGSLIAQKRL
>gnl|bcl2dbpro|A0A1S3NIV8_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Salmo salar GN=BCL-2 (length=228 residues).
MMANENPYNSRFIVEKYIHHKLLNMGFVWKFQAENDSPNNGFGDPSTPNSPEVFARRSQPTAAGEDTDPPYQNRSPQPDP
HARLHRVLRDAGGEIERMYQRDFAEMSGQLHFTPSTAQRRFTAVIDELFSDGVNWGRIVAFFEFGGTMCVESVNREMTSQ
VDNIARWMMEYLNGPLQNWIQENGGWDAFVEIYEQQRISHSWPYLKTVFGLAALGAAGVTIGALFTQK
>gnl|bcl2dbpro|A0A1S3NR66_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Salmo salar GN=MCL-1 (length=274 residues).
VKMSLSFTRATTTILNFQNGVVGGSSYPAGTPLCYFGETVCAGASPKSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVLGN
HMSDRSNDDDSDGSLPCTPQMASECGPELSNCPSGDEVLEHDTRQLIENLLGDYIGLSPPRWKQSKALTTMTRVVKDIIA
KHQYAYNDLFFLGMITLFSDGTTNWGRIASLVAFGAVVSQRLKEMGRGHCIELVGQNIATYLLSDQRDWLVKNNAWNGFV
EFFHVQDPESSVRNALIAFAGFAGLGATLAMLIR
>gnl|bcl2dbpro|A0A1S3NR66_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Salmo salar GN=MCL-1 (length=287 residues).
MSLSFTRATTTILNFQNGVVGGSSYPAGTPLCYFGETVCAGASPKSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVLGNHM
SDRSNDDDSDGSLPCTPQMASECGPELSNCPSGDEVLEHDTRQLIENLLGDYIGLSPPRWKQSKALTTMTRVVKDIIAKH
QYAYNGMIAKLELDDRSDDMSFINSVAKTLFSDGTTNWGRIASLVAFGAVVSQRLKEMGRGHCIELVGQNIATYLLSDQR
DWLVKNNAWNGFVEFFHVQDPESSVRNALIAFAGFAGLGATLAMLIR
>gnl|bcl2dbpro|A0A1S3Q9V5_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Salmo salar GN=BCL-2 (length=230 residues).
MMANDNPYNSRFIVEKYIHHKLLKKGFVWEFNPENDSPNNGFGEPSPPNSPEVFARRSQPSAEGVDTDSPLPNRIPQPDR
HARLHRVLREAGDEIEIMYQRDFAEMSGQLHFTPSTAQRRFTAVIEELFRDGVNWGRIVAFFEFGGTMCVESVNREMTTQ
VDNIAHWMTEYLNGPLQNWIQENGDWDAFVEIYGQQRISVFHSWPYLKTVFGLAALGAAGVTIGALFIQK
>gnl|bcl2dbpro|A0A1S3R1W1_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Salmo salar GN=BCL-2 (length=226 residues).
MANDDNRFIVEKYICHKLLKRGYAWDFEDAEEEEGAANNGSMISPRLGLARRCHGANNAGPSSVPSLSKWLSQPDPHAAI
HRVLREAGDELERLYQPDFAEMSHQLYLTSSTAERRFREVIDELFRDGVNWGRIIAFFEFGGTICVECVNKEMTSQVDHI
AVWMTEYLNGPLLSWIQENGGWEAFVELYDRQRDSVFCSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|B5XAY3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Salmo salar GN=BCL2L1 (length=228 residues).
MMTYNNRELVVYYITYKLSQRDYPFNHMELTEAQNRTEVGQVEGGAAVLTYVNGTSPGTPPPRQSPPSSPRRTAGLDAVK
EALRDSANEFELRYARAFSDLSSQLHITPSTAYQSFENVMDEVFRDGVNWGRVVGLFSFGGALCVECVDKEMNPLVGRIT
DWMTVYLDNHIQPWIQSQGGWDRFAEIFGMDAAAESRKSQESFKKWLLAGMTLVTGVVVGSLFAQKRL
>gnl|bcl2dbpro|C0HAD8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Salmo salar GN=BCL2L1 (length=216 residues).
MSYSNRELVVFFISYRLSQRNYSCCQLGLEGASGRTEGDDAIANGSVGNSRSNLAKPSSPQGGMEPVKAALRDSVDEFEL
RYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSPLVARIADWMTTYLDNHIQ
PWIQSQGGWDRFAEIFGRDAAADVRRSQESIIKWLLVGVILLSGVLVGTLIMKKRQ
>gnl|bcl2dbpro|Q0KFR9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Salmo salar GN=MCL-1 (length=285 residues).
MSLSNSITRATTTMLHFQNGGSSYLADDARPLYYFQGAGAICAGASPKSKVDLGNGTGDTPPRPTTLGVNVVKSNGLDNH
LSDRSNNDDSLPCTPQMASECGPELSNCPSGDEVLEHDTRQLIENFLGDYTGLSQPRWTQSKPLTTMKRVVEDVIAKHRY
AYNGMVAKLDLDDRCDDMGVINSVAKTMFSDGITNWGRIASLVAFGAVVSQHLKERGRGHCVELVGQEIAKYLLSDQSDW
LIKNNAWNGFVEFFHVQDPESSVRNTLLAFAGVAGIGATLAMFIR
© 1998-2022Legal notice