Dataset for protein BCL-2-like of organism Salmo salar

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1S3NR66_MCL1-02      VKMSLSFTRATTTILNFQNGVVGGSSYPA--GTPLCYF--GETVCAGASP
A0A1S3NR66_MCL1-01      MSL--SFTRATTTILNFQNGVVGGSSYPA--GTPLCYF--GETVCAGASP
Q0KFR9_MCL1-01          MSLSNSITRATTTMLHFQN---GGSSYLADDARPLYYFQGAGAICAGASP
A0A1S3LY44_BCL2-01      MANDDN----RCIVEKYICHKLLKRGYAW---------------------
A0A1S3R1W1_BCL2-01      MANDDN----RFIVEKYICHKLLKRGYAW---------------------
A0A1S3NIV8_BCL2-01      MMANENPYNSRFIVEKYIHHKLLNMGFVW---------------------
A0A1S3Q9V5_BCL2-01      MMANDNPYNSRFIVEKYIHHKLLKKGFVW---------------------
C0HAD8_BCL2L1-01        -MSYSN----RELVVFFISYRLSQRNYSC---------------------
A0A1S3MED7_BCL2L1-      -MTYNN----RELVVYYITYKLSQRDYPF---------------------
B5XAY3_BCL2L1-01        MMTYNN----RELVVYYITYKLSQRDYPF---------------------
                             .       :  :        .:                       

A0A1S3NR66_MCL1-02      KSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVLGNHMSDRSNDDDSDGSLP
A0A1S3NR66_MCL1-01      KSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVLGNHMSDRSNDDDSDGSLP
Q0KFR9_MCL1-01          KSKV--DLGNGTGDTPPRPTTLGVNVVKSNGLDNHLSDRSNNDD---SLP
A0A1S3LY44_BCL2-01      -------------------------------DFENAEDEEDADNNGSMIS
A0A1S3R1W1_BCL2-01      -------------------------------DFEDAEEEEGAANNGSMIS
A0A1S3NIV8_BCL2-01      -------------------------------KFQAENDSPNNGFGDPSTP
A0A1S3Q9V5_BCL2-01      -------------------------------EFNPENDSPNNGFGEPSPP
C0HAD8_BCL2L1-01        -------------------------------CQLGLEGASGRTEGD----
A0A1S3MED7_BCL2L1-      -------------------------------NHIGLTEAPSRTEGGQ-AE
B5XAY3_BCL2L1-01        -------------------------------NHMELTEAQNRTEVGQ-VE
                                                                .         

A0A1S3NR66_MCL1-02      CTPQMASECGPELSNCPSGDEVLEHDTRQLIENLLGDYIGLSPPRWKQSK
A0A1S3NR66_MCL1-01      CTPQMASECGPELSNCPSGDEVLEHDTRQLIENLLGDYIGLSPPRWKQSK
Q0KFR9_MCL1-01          CTPQMASECGPELSNCPSGDEVLEHDTRQLIENFLGDYTGLSQPRWTQSK
A0A1S3LY44_BCL2-01      PPPGLARRCHGANNARPGSVPHLSKRLSQ------------TDPHAAIHR
A0A1S3R1W1_BCL2-01      PRLGLARRCHGANNAGPSSVPSLSKWLSQ------------PDPHAAIHR
A0A1S3NIV8_BCL2-01      NSPEVFARRSQPTAAGEDTDPPYQNRSPQ------------PDPHARLHR
A0A1S3Q9V5_BCL2-01      NSPEVFARRSQPSAEGVDTDSPLPNRIPQ------------PDRHARLHR
C0HAD8_BCL2L1-01        ---------DAIANGSVGNSRSNLAKPSS------------PQG--GMEP
A0A1S3MED7_BCL2L1-      GGAAVTTHPNGAANGTSPGTPPRQSPPSS------------PQRTMGLDA
B5XAY3_BCL2L1-01        GGAAVLTYVNGTSPGTP---PPRQSPPSS------------PRRTAGLDA
                                                    .            .        

A0A1S3NR66_MCL1-02      ALTTMTRVVKDIIAKHQYAYNDLFF----------LGMI-----TLFSDG
A0A1S3NR66_MCL1-01      ALTTMTRVVKDIIAKHQYAYNGMIAKLELDDRSDDMSFINSVAKTLFSDG
Q0KFR9_MCL1-01          PLTTMKRVVEDVIAKHRYAYNGMVAKLDLDDRCDDMGVINSVAKTMFSDG
A0A1S3LY44_BCL2-01      V---LREAGDELERLYQPDFAEMSHQLYLTSSMAERRFR-EVIDELFRDG
A0A1S3R1W1_BCL2-01      V---LREAGDELERLYQPDFAEMSHQLYLTSSTAERRFR-EVIDELFRDG
A0A1S3NIV8_BCL2-01      V---LRDAGGEIERMYQRDFAEMSGQLHFTPSTAQRRFT-AVIDELFSDG
A0A1S3Q9V5_BCL2-01      V---LREAGDEIEIMYQRDFAEMSGQLHFTPSTAQRRFT-AVIEELFRDG
C0HAD8_BCL2L1-01        VKAALRDSVDEFELRYTRAFSDLSSQLHITPATAYHSFE-SVMDEVFRDG
A0A1S3MED7_BCL2L1-      VKEALRDSANEFELRYARAFSDLSSQLHITPATAYQSFE-NVMDEVFRDG
B5XAY3_BCL2L1-01        VKEALRDSANEFELRYARAFSDLSSQLHITPSTAYQSFE-NVMDEVFRDG
                            :     :.   :   :  :              .       :* **

A0A1S3NR66_MCL1-02      TTNWGRIASLVAFGAVVSQRLKEMGRGHCIELVGQNIATYLLSDQRDWLV
A0A1S3NR66_MCL1-01      TTNWGRIASLVAFGAVVSQRLKEMGRGHCIELVGQNIATYLLSDQRDWLV
Q0KFR9_MCL1-01          ITNWGRIASLVAFGAVVSQHLKERGRGHCVELVGQEIAKYLLSDQSDWLI
A0A1S3LY44_BCL2-01      V-NWGRIVAFFEFGGTICVECVNKEMTSQVDHIAGWMTEYLNGPLHSWIQ
A0A1S3R1W1_BCL2-01      V-NWGRIIAFFEFGGTICVECVNKEMTSQVDHIAVWMTEYLNGPLLSWIQ
A0A1S3NIV8_BCL2-01      V-NWGRIVAFFEFGGTMCVESVNREMTSQVDNIARWMMEYLNGPLQNWIQ
A0A1S3Q9V5_BCL2-01      V-NWGRIVAFFEFGGTMCVESVNREMTTQVDNIAHWMTEYLNGPLQNWIQ
C0HAD8_BCL2L1-01        V-NWGRVVGLFAFGGALCVECVEKDMSPLVARIADWMTTYLDNHIQPWIQ
A0A1S3MED7_BCL2L1-      V-NWGRVVGLFAFGGALCVECVEKEMSPLVGRIADWMTVYLDNHIQPWIQ
B5XAY3_BCL2L1-01        V-NWGRVVGLFSFGGALCVECVDKEMNPLVGRITDWMTVYLDNHIQPWIQ
                          ****: .:. **..:.    :      :  :   :  ** .    *: 

A0A1S3NR66_MCL1-02      KNNAWNGFVEFFHVQDPESSVRN-----------ALIAFAGFAGLGATLA
A0A1S3NR66_MCL1-01      KNNAWNGFVEFFHVQDPESSVRN-----------ALIAFAGFAGLGATLA
Q0KFR9_MCL1-01          KNNAWNGFVEFFHVQDPESSVRN-----------TLLAFAGVAGIGATLA
A0A1S3LY44_BCL2-01      ENGGWEAFVELYD-------RQRDSVFCSWPSIKTVFGLAALGAASLTIG
A0A1S3R1W1_BCL2-01      ENGGWEAFVELYD-------RQRDSVFCSWPSIKTVFGLAALGAASLTIG
A0A1S3NIV8_BCL2-01      ENGGWDAFVEIYE-------QQRIS--HSWPYLKTVFGLAALGAAGVTIG
A0A1S3Q9V5_BCL2-01      ENGDWDAFVEIYG-------QQRISVFHSWPYLKTVFGLAALGAAGVTIG
C0HAD8_BCL2L1-01        SQGGWDRFAEIFGRDAAADVRRSQESIIKWLLVGVIL------LSGVLVG
A0A1S3MED7_BCL2L1-      SQGGWDRFAEIFGKDAAAESRKSQENFKKWLLAGMTL------VTGVIVG
B5XAY3_BCL2L1-01        SQGGWDRFAEIFGMDAAAESRKSQESFKKWLLAGMTL------VTGVVVG
                        .:. *: *.*::         .              :        .  :.

A0A1S3NR66_MCL1-02      MLIR----
A0A1S3NR66_MCL1-01      MLIR----
Q0KFR9_MCL1-01          MFIR----
A0A1S3LY44_BCL2-01      AYLTQK--
A0A1S3R1W1_BCL2-01      AYLTQK--
A0A1S3NIV8_BCL2-01      ALFTQK--
A0A1S3Q9V5_BCL2-01      ALFIQK--
C0HAD8_BCL2L1-01        TLIMKKRQ
A0A1S3MED7_BCL2L1-      SLIAQKRL
B5XAY3_BCL2L1-01        SLFAQKRL
                          :     

© 1998-2022Legal notice