Dataset for protein BCL-2-like of organism Rhinolophus ferrumequinum

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------mlglkrnaviglnlycggsglgagsggsaspsgerllaag---------------------
mahagrtsysnrepvvsyv-yktsqrgyew-asdas-vss-pt-ape---a-pg-tpsakpatarreagggeagaviggs
      mgqpaq lgskslsmasrasnwvar-g---r---n--r---vvs-r-eekgtpdelhqgmygn l seelep e
        md   i mdfiqvrapvp rt-pi-vvdfreykrrqrrystggqm-tg eda gg adr a d         
                  ah q eek pstd  qf dn t l pkchlha el ra d                      
                   c   a a ad a  a  aa e   eh gif  ag                           
                                               gc                               
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
agasppatlapdarrvarpsppgaeqqrftqvsdelfqgspdvtatparrlfgapsfresplkpglvemeplvgqvqewm
llletrprrtfselpprprvti sp              g nwgslv ffv f alsqaevne     sdagd aied  
  f  efepe edeaaqlha    a                gp r          gca  ee                  
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------------------------lrsspp-----------
vayletrladwihssggpeleaimsrvremegyepeplgkrpevqplvervmnmspppgnsgsvpmtiepkmeeeersly
                 waad  kapee ld     eae lkallnel kqeea ng  ma paitrkseaeladadeiw
                                                               ingpfavnk ktll s 
                                                               fldn             
                                                                k a             
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                             .                 :.      .                        
---------------tgsvdy-amgrslsasr----------kaldtlrrvgdgvqrryetaf-sgmlskldiknftdvk
rqsleiisrylreqlvdnla-kptapeaethpldarevipsahvcgvvnsatilfdknh---wkqclprqfhytpedare
qkmtdcefg ihwlaa-ak-ag-rvetthsvf        msvgsrs qqiasscsl--rrvl pehtkg-a-iegsrkv
            rp -a--t vvq aqpgpls         prtkqa  e  aq e evqln  adysg-d-myqdn yt
            ph q yp  cln  aga g           pkhl   d   e      kd     r f vlsi    q
            a    pa    a                  a aa       d             d           g
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .                 .    :                                   :.                  
svsrvmihvfsdg-vtnwgrivtlisfggfv--------------crhlksinqeslvepiatwitdvlvrtkr------
rl-q---e-----r-----htsaffdesavllkkpppgrrlrlkeakesvvrpmrtcipglsesmrtf---htarlgerg
lfe- ve-llr    vr   v lale eltrie l          gvqiitpekqvnrd- cytdagyineprh      
i nt aqki h    p       r a a im              leaq nkdvspyksr  lfvser tdglg      
  a   n e e    i       i     a                  d d  cd   an  d l    a   e      
                                                           l                    
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                             :       :                                          
----------------------------dwlvk-qrgwds-fvefygpnn--e-gr------------ywllaratvagv
qgtreglagrasrdaplrrapgdlvapvryiqrfngnyn-srsrlfsgfesr-s--vrprfnfswlslnvgr-l-gswys
                            p ras ttr evpgrvvqfvvslaprrwrqel d      -r--tfv--g-c
                            t arq  q  -tgefqkhlspmeqggipkk          s-vts-svt-ki
                            e  he     rndacke hnkldldt kg           rapklselqyca
                                d      m       hedae   ie           k   fg el a 
                                       g       eaa                  g           
                                       a                                        

       490 
....:....|.
           
sy----l-r--
pllgay-k-kc
gaglsliiqy 
vtmfc fshf 
ied    g   
cc         
           
           
© 1998-2020Legal notice