Dataset for protein BCL-2-like of organism Rhinolophus ferrumequinum

[Download (right click)] [Alignment] [Repertoires]

9 sequence(s)

>gnl|bcl2dbpro|A0A671DJP1_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=BCL2L10 (length=226 residues).
VCVQLRERNWVKADGLRSRPARLLTDSLAYCARGPSTATLPPSAPKAAVLRSVAAQVQRRYQLVWSCYRGYQGNRVVLVE
QVAQEILHDGRVPRWGHVVARISFAGTLLEKPPPGRRLRLKECEADVSRDCQSLVALLCDWLSTRLARGTRRLGERGQGT
REGLAGRASRDAPLRRAPGDLVAPVPWAHSFQQRWEVECEFQLSPLLAESGWEKPASLDGSLIKRF
>gnl|bcl2dbpro|A0A671DWB3_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=BCL2L2 (length=333 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RGRARATSWYSPY
>gnl|bcl2dbpro|A0A671DWB3_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=BCL2L2 (length=307 residues).
MAAAAAAATAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPGELLLEPEPEPEPEEEPPRPRA
PPGAPGPGPGSGAPGSQEEEEEPGLVESDPGDGAIEDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV
IMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRG
RQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|A0A671EYI9_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTASEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWVLTGVTLAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A671FEY2_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=BCL-2 (length=232 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAASSGATPAPGIFSSQPERTPAPARTSPPPPLAAPAAAAGPALS
PVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMS
PLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPNMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A671FLY8_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=BCL2A1 (length=245 residues).
MPAQEPGSSSAQLRSEVPGREAPISDVSRNSTGPTSHCESHPARLGTLASDFLSPFPVNKLKTLLSSWQKMTDCEFGYIH
ALAQDYLTYVLQVPQPGTGPSRTSRVLQDIASSVQKEVEKNLKPCLDSFDVMSIDTARTIFNQVMEKEFEDGVINWGRIV
TIFAFEGILIKKLLREQITPDVDTYKDISYFVADFITEHTGEWIRQNGGWENGFVKKFGPKSGWLTFLEVTGKICEMFCL
LKQYC
>gnl|bcl2dbpro|A0A671G0G2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=MCL-1 (length=347 residues).
MLGLKRNAVIGLNLYCGGSGLGAGSGGSASPSGERLLAAGKEATARREAGGGEAGAVIGGSAGASPPATLAPDARRVARP
SPIGAESPDVTATPARRLFFAPSFRASPLKEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLERVEEASNGPGMSGS
LPSTPPPAEEEEEDELYRQSLEIISRYLREQATGAKDAKPMGRSASASRKALDTLRRVGDGVQRNHETAFQGMLRKLDIK
NEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWRMPARQ
VHFEAEEQDTGPKSWPKLSSEQYCCSC
>gnl|bcl2dbpro|A0A671G0G2_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=MCL-1 (length=352 residues).
MLGLKRNAVIGLNLYCGGSGLGAGSGGSASPSGERLLAAGKEATARREAGGGEAGAVIGGSAGASPPATLAPDARRVARP
SPIGAESPDVTATPARRLFFAPSFRASPLKEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLERVEEASNGPGMSGS
LPSTPPPAEEEEEDELYRQSLEIISRYLREQATGAKDAKPMGRSASASRKALDTLRRVGDGVQRNHETAFQGMLRKLDIK
NEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEF
FHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A671G0G2_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=MCL-1 (length=198 residues).
MLGLKRNAVIGLNLYCGGSGLGAGSGGSASPSGERLLATGAKDAKPMGRSASASRKALDTLRRVGDGVQRNHETAFQGML
RKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGW
DGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2020Legal notice