Dataset for protein BCL-2-like of organism Rhinolophus ferrumequinum

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A671G0G2_MCL1-01      -------------------MLGLKRNAVIGLNLYCGGSGLGAGSGGSASP
A0A671G0G2_MCL1-02      -------------------MLGLKRNAVIGLNLYCGGSGLGAGSGGSASP
A0A671DWB3_BCL2L2-      --------------------MATPASAPDTRALVADFVGYKLRQKGYVCG
A0A671DWB3_BCL2L2-      --------------------MAAAAAAATAAAGAAGGRGSGPGRRRHLVP
A0A671G0G2_MCL1-03      -------------------MLGLKRNAVIGLNLYCGGSGLGAGSGGSASP
A0A671FLY8_BCL2A1-      --------MPAQEPGSSSAQLRSEVPGREAPISDVSRNSTGPTSHCESHP
A0A671DJP1_BCL2L10      ------------------VCVQLRERNWV---------------------
A0A671EYI9_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSW--SQFSDVEENRTEAPEGTA
A0A671FEY2_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAASSGATPAPGIFS
                                                                          

A0A671G0G2_MCL1-01      SGERLLAAGKEATARREAGGGEAGAVIGGSAGASPPATLAPDARRVARPS
A0A671G0G2_MCL1-02      SGERLLAAGKEATARREAGGGEAGAVIGGSAGASPPATLAPDARRVARPS
A0A671DWB3_BCL2L2-      AGPGEGPAADPLHQAMRAAGDE----------FETRFRRTFSDLAAQLHV
A0A671DWB3_BCL2L2-      GAGGEAGEGAPGGAGDYGNGLESEELEPGELLLEPEPEPEPEEEPPRPRA
A0A671G0G2_MCL1-03      SGERLLATG-----------------------------------------
A0A671FLY8_BCL2A1-      ARLGTLASD-----------------------------------------
A0A671DJP1_BCL2L10      -----KADG-----------------------------------------
A0A671EYI9_BCL2L1-      SEME-TPSA-----------------------------------------
A0A671FEY2_BCL2-01      SQPERTPAP-----------------------------------------
                                                                          

A0A671G0G2_MCL1-01      PIGAE--------------SPDVTATPARRLFFAPSFRASPLK----EME
A0A671G0G2_MCL1-02      PIGAE--------------SPDVTATPARRLFFAPSFRASPLK----EME
A0A671DWB3_BCL2L2-      TPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNK----EME
A0A671DWB3_BCL2L2-      PPGAP--------------GPGPGS-------GAPGSQEEEEEPGLVESD
A0A671G0G2_MCL1-03      --------------------------------------------------
A0A671FLY8_BCL2A1-      --------------------------------------------------
A0A671DJP1_BCL2L10      --------------------------------------------------
A0A671EYI9_BCL2L1-      --------------------------------------------------
A0A671FEY2_BCL2-01      --------------------------------------------------
                                                                          

A0A671G0G2_MCL1-01      A--------------------------PAADAIMSPEEELDGYEPEPLGK
A0A671G0G2_MCL1-02      A--------------------------PAADAIMSPEEELDGYEPEPLGK
A0A671DWB3_BCL2L2-      PLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREME----EEAEK
A0A671DWB3_BCL2L2-      PGDGAIED-------------------PELEAIKARVREME----EEAEK
A0A671G0G2_MCL1-03      --------------------------------------------------
A0A671FLY8_BCL2A1-      --------------------------------------------------
A0A671DJP1_BCL2L10      --------------------------------------------------
A0A671EYI9_BCL2L1-      --------------------------------------------------
A0A671FEY2_BCL2-01      --------------------------------------------------
                                                                          

A0A671G0G2_MCL1-01      RPAVLPLLERVEEASNGPGMSGSLPSTPPPAEEEEEDELYRQSLEIISRY
A0A671G0G2_MCL1-02      RPAVLPLLERVEEASNGPGMSGSLPSTPPPAEEEEEDELYRQSLEIISRY
A0A671DWB3_BCL2L2-      LKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIY----------
A0A671DWB3_BCL2L2-      LKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIY----------
A0A671G0G2_MCL1-03      -----------------------AKDAKP---------------------
A0A671FLY8_BCL2A1-      -----------------------FLSPFPVNKLKTLLSSWQKMTDCEFGY
A0A671DJP1_BCL2L10      -----------------------LRSRPA---------------------
A0A671EYI9_BCL2L1-      -----------------------INGNPS---------------------
A0A671FEY2_BCL2-01      -----------------------ARTSPP---------------------
                                                                          

A0A671G0G2_MCL1-01      LREQATGAKDAKPMGRSASASR----------KALDTLRRVGDGVQRNHE
A0A671G0G2_MCL1-02      LREQATGAKDAKPMGRSASASR----------KALDTLRRVGDGVQRNHE
A0A671DWB3_BCL2L2-      -----VGNVDYGATAEELEAHF----------HGCGSVNRVTILCDK---
A0A671DWB3_BCL2L2-      -----VGNVDYGATAEELEAHF----------HGCGSVNRVTILCDK---
A0A671G0G2_MCL1-03      -------------MGRSASASR----------KALDTLRRVGDGVQRNHE
A0A671FLY8_BCL2A1-      IHALAQDYLTYVLQVPQPGTGP---------SRTSRVLQDIASSVQKEVE
A0A671DJP1_BCL2L10      --RLLTDSLAYCARGPSTATLP-------PSAPKAAVLRSVAAQVQRRYQ
A0A671EYI9_BCL2L1-      --WHLADSPA--VNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYR
A0A671FEY2_BCL2-01      --PPLAAPAA--AAGPALSPVP---------PVVHLTLRQAGDDFSRRYR
                                           .                 :.      .    

A0A671G0G2_MCL1-01      TAF-QGMLRKLDIKNEDDVKSLSRVMIHVFSDG-VTNWGRIVTLISFGAF
A0A671G0G2_MCL1-02      TAF-QGMLRKLDIKNEDDVKSLSRVMIHVFSDG-VTNWGRIVTLISFGAF
A0A671DWB3_BCL2L2-      --F-SGHPKGFAYIEFSDKESV-----------------RTSLALDESLF
A0A671DWB3_BCL2L2-      --F-SGHPKGFAYIEFSDKESV-----------------RTSLALDESLF
A0A671G0G2_MCL1-03      TAF-QGMLRKLDIKNEDDVKSLSRVMIHVFSDG-VTNWGRIVTLISFGAF
A0A671FLY8_BCL2A1-      KNLKPCLDSFDVMSIDTARTIFNQVMEKEFEDG-VINWGRIVTIFAFEGI
A0A671DJP1_BCL2L10      LVW-SCYRG----YQGNRVVLVEQVAQEILHDGRVPRWGHVVARISFAGT
A0A671EYI9_BCL2L1-      RAF-SDLTSQLHITPGTAYQSFEQVVNELFRDG--VNWGRIVAFFSFGGA
A0A671FEY2_BCL2-01      RDF-AEMSSQLHLTPFTARGRFATVVEELFRDG--VNWGRIVAFFEFGGV
                                             .                 .    :     

A0A671G0G2_MCL1-01      V--------------AKHLKSINQESCIEPLAESITDVLVRTKR------
A0A671G0G2_MCL1-02      V--------------AKHLKSINQESCIEPLAESITDVLVRTKR------
A0A671DWB3_BCL2L2-      R--------------GRQIKVIPKRTNRPGISTTDRGF---PRA------
A0A671DWB3_BCL2L2-      R--------------GRQIKVIPKRTNRPGISTTDRGF---PRA------
A0A671G0G2_MCL1-03      V--------------AKHLKSINQESCIEPLAESITDVLVRTKR------
A0A671FLY8_BCL2A1-      LIKKL----------LREQITPDVDTYKD-ISYFVADFITEHTG------
A0A671DJP1_BCL2L10      LLEKPPPGRRLRLKECEADVSRDCQSLVALLCDWLSTRLARGTRRLGERG
A0A671EYI9_BCL2L1-      L--------------CVESVDKEMQVLVSRIATWMATYLNDHLE------
A0A671FEY2_BCL2-01      M--------------CVESVNREMSPLVDNIALWMTEYLNRHLH------
                                                      :.                  

A0A671G0G2_MCL1-01      ----------------------------DWLVK-QRGWRMPARQVHFEAE
A0A671G0G2_MCL1-02      ----------------------------DWLVK-QRGW--DGFVEFFHVE
A0A671DWB3_BCL2L2-      ----------------------------RYRAR-TTNYNSSRSRFYSGFN
A0A671DWB3_BCL2L2-      ----------------------------RYRAR-TTNYNSSRSRFYSGFN
A0A671G0G2_MCL1-03      ----------------------------DWLVK-QRGWDG-FVEFFHVED
A0A671FLY8_BCL2A1-      ----------------------------EWIRQ-NGGWENGFVKKFGPKS
A0A671DJP1_BCL2L10      QGTREGLAGRASRDAPLRRAPGDLVAPVPWAHSFQQRWEV-ECEFQLSPL
A0A671EYI9_BCL2L1-      ----------------------------PWIQE-NGGWDT-FVELYGNNA
A0A671FEY2_BCL2-01      ----------------------------TWIQD-NGGWDA-FVELYGPNM
                                                     :       :            

A0A671G0G2_MCL1-01      EQDTGPK-----------SWPKLSSEQYCCSC---------
A0A671G0G2_MCL1-02      DLEGGIR-----------NVLLAFAGVAGVGAGLAYLIR--
A0A671DWB3_BCL2L2-      SRPRGRV-----------YRGRARATSWYSPY---------
A0A671DWB3_BCL2L2-      SRPRGRV-----------YRGRARATSWYSPY---------
A0A671G0G2_MCL1-03      LEGGIR------------NVLLAFAGVAGVGAGLAYLIR--
A0A671FLY8_BCL2A1-      ------------------GWLTFLEVTGKICEMFCLLKQYC
A0A671DJP1_BCL2L10      LAESGWEKP--------------------ASLDGSLIKRF-
A0A671EYI9_BCL2L1-      AAESRKGQERFN------RWVLTGVTLAGVVLLGSLFSRK-
A0A671FEY2_BCL2-01      -------RPLFDFSWLSLKALLSLALVGACITLGAYLGHK-
                                                                 

© 1998-2020Legal notice