Dataset for protein BCL-2-like of organism Pongo abelii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160
mimtmqpsitrtpqexfqerpqill-pyeefeapeenries p            kesepgpllelp hspnntssrgrl
hadcdglre a ad f h a e ka eld      a aga               aap meif ain epghhagdddpe
   a fg          f        d                                                ccaaa

       170       180       190       200       210       220       230       240
   .                                                *.     .                    
--stpsssplegavyr-vlssvsry-reqatgakdtkplgrsgatcrkalq- krvlanfrvvh-----g---q-hiyvf
rtq lhgeekdeellqqsafpiqpvlk                       ln  qca glqqn-etf qeytrk dlsne
nsa e a aead e ikm ei pke h                       ka  p   e nll  sd adlsg    k d
         a a   g a     aa e                       e   e   d e        a          

       250       260       270       280       290       300       310       320
     .  :    : *.    ***:*::. * . :                    :    :          :   ::  :
nrrqlvstmmvsllr sptpn   v afvt eatvlkrgplvtarwkkwgfqprletqrrqvsvd--tykplvysvatvv
ddykrlnr anke e  is t      iie a imieh                k llekdsqrecs   n slllssr 
   g  el  dh      i          a   f a                    eidg ici  q   e  efdf 
   e                             a                                              

       330       340       350       360       370       380       
      *:  : **:  *                             ::   .       : :    
nntthp lvkqr  ent ckffrvpmplgswrkqpvfnfswlslrvfmslmvtaaivtmgalfl-kc
mgqkgg  ke      a  hklhtnlleegrkgrlr d      qtw aglt tkfglgwtr kqy 
 dnhed   d            enkdaaafi   el        ng   ceg   cce     ih  
     a   a              ea                  ka           a     g   
© 1998-2022Legal notice