Dataset for protein BCL-2-like of organism Pongo abelii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      :  :                                                                      
mfglkrnaviglnl-----------ycggaglgagsggatppggrll---------------------------------
----qterelvydylsyrtsrllys-------e----e---------atekeasarreigggeagaviggsagasppstl
 vmsmsdctftvif rekleqkgadwsqfsdv-pntt-ppegteseme psaingnpswhladsp  n atghs sld  
  dql      a              l ccar e rp                                           
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
tpdsrrvarpppigaevpdvtatparlfffaptrraapleemeapaadaimspeeeldgyepeplgkrpavlpllelvge
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                           .   *.     .         
----------------------------------------atgakdtkplgrsgatcrkaletLrrvgdgvqrnhetafq
sgnntstdgslpstpppaeeeedelyrqsleiisrylreq----------tqevsvpssvsrv qq----lhlsyrsnys
                                      laqdylqyvlqipppaipmaa kqr  kaafsfekrvfr ll
                                                  a    gl   aaa  e   e   ef k  k
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
gmlr-l-i-pgddvksl-srvmvhvfsdgv--nwgrivtlisf-------gglvckhlktinqqscv-----------er
py--k-d-kne------f-q----------tp--------f--agtllereaflavrwvr-rmeprikeqegdvartysp
dwvsqvnvv--ttyrtv n-mvnsllr sps t   v ai-t         viptrksrnwqiavll        ddcqg
 ltdn h tsvnraqlf el aeke e  ii        fva         pa iagpldqgh kda           ke
 c c        a e   a   de                                e   kef               a 

       330       340       350       360       370       380       390   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
:              *:                                               :        
laesitsvlvrtkrdWlvkqggwdgfveffh--------r--l---------mavagvagvgaklayl-----
ivawvad------gs iq-nr----------vedleggi-nv-rfnrwfltgl-f----llttgfsl-irrll
fsylmwtyvnnqtep f-q--  gtwhnlyrtplpleswkkqe         -t-fssvhksslmirkwt   
 crflser mgnl g  ke     k chhtpnnaaaafr g           vqael c ikrai        
   cc  f  dhh a   a           g                      l        n          
© 1998-2022Legal notice