Dataset for protein BCL-2-like of organism Pongo abelii

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H2NNZ9_BCL2A1-01        ----MTDCEFGYIY------------------------------------
A0A2J8VIH3_BCL2L1-      --MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETP
H2N5Y9_MCL1-01          MFGLKRNAVIGLNL-----------YCGGAGLGAGSGGATPPGGRLLATE
H2N5Y9_MCL1-02          MFGLKRNAVIGLNL-----------YCGGAGLGAGSGGATPPGGRLLATE
H2N5Y9_MCL1-03          MFGLKRNAVIGLNL-----------YCGGAGLGAGSGGATPPGGRLL---
H2NN92_BCL2L10-01       MVDQLRERTITADLLRERTERLLADYLGCCAREPGTPEPTPP--------
                              :  :                                        

H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2J8VIH3_BCL2L1-      SAINGNPSWHLADSPAVNGATGHSSSLD----------------------
H2N5Y9_MCL1-01          KEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDV
H2N5Y9_MCL1-02          KEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDV
H2N5Y9_MCL1-03          --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
                                                                          

H2NNZ9_BCL2A1-01        --------------------------------------------------
A0A2J8VIH3_BCL2L1-      --------------------------------------------------
H2N5Y9_MCL1-01          TATPARLFFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPA
H2N5Y9_MCL1-02          TATPARLFFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPA
H2N5Y9_MCL1-03          --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
                                                                          

H2NNZ9_BCL2A1-01        -----------------------------------------------RLA
A0A2J8VIH3_BCL2L1-      --------------------------------------------------
H2N5Y9_MCL1-01          VLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQ
H2N5Y9_MCL1-02          VLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQ
H2N5Y9_MCL1-03          --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
                                                                          

H2NNZ9_BCL2A1-01        QDYLQYVLQIPQPGSGPSKASRVLQKVAFSVQKEVEKNLKPCLDNVNVVS
A0A2J8VIH3_BCL2L1-      ----------AREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITP
H2N5Y9_MCL1-01          ATGAKDTKPLGRSGATCRKALETLRRVGDGVQRNHETAFQGWVC------
H2N5Y9_MCL1-02          ATGAKDTKPLGRSGATCRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN
H2N5Y9_MCL1-03          ATGAKDTKPLGRSGATCRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN
H2NN92_BCL2L10-01       ----------TPEAAVLRSAAARLRQ----LHRSFFSAYLGY-------P
                                           .   *.     .                   

H2NNZ9_BCL2A1-01        VDTARTLFNQVMEKEFEDGII-NWGRIVTIFAF-------EGILIKKLLR
A0A2J8VIH3_BCL2L1-      GTAYQSF-EQVVNELFRDGV--NWGRIVAFFSF-------GGALCVESVD
H2N5Y9_MCL1-01          ----------------------------------------GVLPCRGPRR
H2N5Y9_MCL1-02          EDDVKSL-SRVMVHVFSDGVT-NWGRIVTLISF-------GAFVAKHLKT
H2N5Y9_MCL1-03          EDDVKSL-SRVMVHVFSDGVT-NWGRIVTLISF-------GAFVAKHLKT
H2NN92_BCL2L10-01       GNRVELV-ALMADSVLSDSPSPTWGRVVTLVTFAGTLLERGPLVTARWKN
                                                                          

H2NNZ9_BCL2A1-01        QQIAPDV--------DTYKEISYFVAEFVMNNTGGWIKQNGGWGKWHNHT
A0A2J8VIH3_BCL2L1-      KEMQVLV-----------SRIAAWMATYLNDHLEPWIQENGGWDTFVELY
H2N5Y9_MCL1-01          -RHQKCA-----------AGFCRCCWS------RSWF-------------
H2N5Y9_MCL1-02          INQESCI-----------EPLAESITDVLVRTKRDWLVKQRGWDGFVEFF
H2N5Y9_MCL1-03          INQESCI-----------EPLAESITDVLVRTKRDWLVKQRGWDGFVEFF
H2NN92_BCL2L10-01       WGFQPRLKEQEGDVARDCQRLVALLSSRLVGQHRAWLQAQGGWDGFCHFF
                                            :              *:             

H2NNZ9_BCL2A1-01        P---------------------MLVESVAHKKRKMAL------
A0A2J8VIH3_BCL2L1-      GNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK-----
H2N5Y9_MCL1-01          -----------------------------GISNKIALL-----
H2N5Y9_MCL1-02          HVEDLEGGIRNVL---------LAFAGVAGVGAGLAYLIR---
H2N5Y9_MCL1-03          HVEDLEGGIRNVL---------LAFAGVAGVGAGLAYLIR---
H2NN92_BCL2L10-01       RTPLPLAFWRKQL---------VQAFLSCLLTTAFIYLWTRLL
                                                          :        

© 1998-2022Legal notice