Dataset for protein BCL-2-like of organism Pongo abelii

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A2J8VIH3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Pongo abelii GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|H2N5Y9_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pongo abelii GN=MCL-1 (length=197 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATGAKDTKPLGRSGATCRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|H2N5Y9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pongo abelii GN=MCL-1 (length=271 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPP
PIGAEVPDVTATPARLFFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPLGRSGATCRKALETLRRVGDGVQRNHETAFQGWVCGVLPCRG
PRRRHQKCAAGFCRCCWSRSWFGISNKIALL
>gnl|bcl2dbpro|H2N5Y9_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pongo abelii GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPP
PIGAEVPDVTATPARLFFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPLGRSGATCRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|H2NN92_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Pongo abelii GN=BCL2L10 (length=204 residues).
MVDQLRERTITADLLRERTERLLADYLGCCAREPGTPEPTPPTPEAAVLRSAAARLRQLHRSFFSAYLGYPGNRVELVAL
MADSVLSDSPSPTWGRVVTLVTFAGTLLERGPLVTARWKNWGFQPRLKEQEGDVARDCQRLVALLSSRLVGQHRAWLQAQ
GGWDGFCHFFRTPLPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL
>gnl|bcl2dbpro|H2NNZ9_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Pongo abelii GN=BCL2A1 (length=163 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKASRVLQKVAFSVQKEVEKNLKPCLDNVNVVSVDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFVMNNTGGWIKQNGGWGKWHNHTPMLVESVAHKKRK
MAL
© 1998-2022Legal notice