Dataset for protein BCL-2-like of organism Phasianus colchicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              .  :  *                                  .                 .      
------mfyynrelvidyvsY------------------------------vlqgspsgp-r--p-g-av-trvvh----
mamptrrssvvyyiaqkfnq klsqrgydwseleerppvrtdtaptaeptscgneghlwhh-pp-t-s--nsktpprssl
  hegaegask na lg ll     k hc aag dedenppal ae amda aga ags gq grp hvamgealeaeg 
         d        ih                                 a      a  e a g  aea a     

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             .**  .. .  .    :  :  .: :.       .   *  : * **  ****::::: **. :   
-------------aLRragdefsrryerafsqmlsqlhitpvtayqrfvq-VveelFsDGv-NWGRivtffsFGgvlcve
rvheivrpsgvrqv  qvassvqqqtrldlrpltrrielksgevlksvfng mnnv r  nt    vmalit  alvtkk
e    paapd hlt  ni  glmlkhqe  qgfsgk d  kfddhgaiee  aa k h           i e   fma h
                    ed      ad  d      e  a   ca       a                 a    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  .            :   :*  :      *:  :***   ::                  .     .        .   
svsrems---vlvssiaywmTeylvshlrpWiqsnGGWe-gfvtlfr----pl------s-rtvlssfstvacitagayy
lqnknvrltgpekgrlvtii taitrskhn lmeq   lnlwlmkyivsmr--fdfswi-rkrspplvlvttgsglsvps
 keigqq   kcieq ssf   nnn de  dd    d a iefvgniipes      cl nlgmalagihdlfcalfr
  dh  e   e  dn  g      id  aa   a         d  eledl         i ei l    g   c   al

       250     
....:....|....:
  .            
psr------------
miqeyyegaacsaaf
lhk gw         
gf             
© 1998-2020Legal notice