Dataset for protein BCL-2-like of organism Phasianus colchicus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A669P0Q7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Phasianus colchicus GN=BCL2L1 (length=234 residues).
MSSSNRELVIDFVSYKLSQKGHCWSELEEEDENRTDTAAEAEMDSVLNGSPSWHPPAGHVVNGATVHRSSLEVHEIVRAS
DVRQALRDAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFHDGVNWGRIVAFFSFGGALCVESVDKEMRVLVG
RIVSWMTTYLTDHLDPWIQENGGWLLWIMLVILIIPPLCRRELGPSLSTTHCSCCGAPRPSQEGWEGAACSAAF
>gnl|bcl2dbpro|A0A669PDH6_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Phasianus colchicus GN=BCL-2 (length=233 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRPPVPPALAPTAAPTAVAAAGASSHHRPEPPGSAAASEVPPAEGL
RPAPPGVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTAHGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREM
SPLVDNIATWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A669PVQ4_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Phasianus colchicus GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDITSVDVAKRIFNGVMEEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIINNKAAWIDANGGWENGFLTKFERRSPLSFSTIT
DIFAAVFSLFREYY
>gnl|bcl2dbpro|A0A669R428_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Phasianus colchicus GN=MCL-1 (length=179 residues).
MFAVKRNAVIGFNLYCGGGGPGGPGRPGRTGGAVMEKALETLRRVGDGVMQKHELAFQGMLRKLEIKKEEDLQAVCEVAA
NVFSDGVTNWGRVVTLISFGAFVAKHLKSINQEKCISSLAGIITDALVSSKREWLMSQGGWEGFVDFFRVEDLESSIRNV
LMAFAGVAGLGASLAYMIR
© 1998-2020Legal notice