Dataset for protein BCL-2-like of organism Phasianus colchicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A669PVQ4_BCL2A1-      --METAEFYYVYYLAQDYLQY-----------------------------
A0A669R428_MCL1-01      ------MFAVKRNAVIGFNLY-----------------------------
A0A669P0Q7_BCL2L1-      ------MSSSNRELVIDFVSYKLSQKGHCWSELEEEDENRTDTAAEAEMD
A0A669PDH6_BCL2-01      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRPPVPPALAPTAAPT
                                      .  :  *                             

A0A669PVQ4_BCL2A1-      -VLQESHLGPAQ---------TRVAH-----------------VLRNIAS
A0A669R428_MCL1-01      -CGGGGPGGPGRPGRTGGAVMEKALE-----------------TLRRVGD
A0A669P0Q7_BCL2L1-      SVLNGSPSWH---PPAGHVVNGATVHRSSLEVHEIVRASDVRQALRDAGD
A0A669PDH6_BCL2-01      AVAAAGASSHHRPEPPGSAAASEVPPAEGLR----PAPPGVHLALRQAGD
                             .                 .                   .**  ..

A0A669PVQ4_BCL2A1-      SLQDQTEEALRPFLDRIDITSVDVAKRIFNGVMEEKFADGNTNWGRIMTI
A0A669R428_MCL1-01      GVMQKHELAFQGMLRKLEIKKEEDLQAVCE-VAANVFSDGVTNWGRVVTL
A0A669P0Q7_BCL2L1-      EFELRYRRAFSDLTSQLHITPGTAYQSFEQ-VVNELFHDGV-NWGRIVAF
A0A669PDH6_BCL2-01      EFSRRYQRDFAQMSGQLHLTPFTAHGRFVA-VVEELFRDGV-NWGRIVAF
                         .  .    :  :  .: :.       .   *  : * **  ****::::

A0A669PVQ4_BCL2A1-      FTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIINNKAAWIDANGGWEN
A0A669R428_MCL1-01      ISFGAFVAKHLKSINQE---KCISSLAGIITDALVSSKREWLMSQGGWE-
A0A669P0Q7_BCL2L1-      FSFGGALCVESVDKEMR---VLVGRIVSWMTTYLTDHLDPWIQENGGWL-
A0A669PDH6_BCL2-01      FEFGGVMCVESVNREMS---PLVDNIATWMTEYLNRHLHNWIQDNGGWD-
                        : **. :     .            :   :*  :      *:  :***  

A0A669PVQ4_BCL2A1-      GFLTKFE--------------RRSPLSFSTITDIFAAVFSLFREYY----
A0A669R428_MCL1-01      GFVDFFRVEDLES------SIRNVLMAFAGVAGLGASLAYMIR-------
A0A669P0Q7_BCL2L1-      LWIMLVILIIPPL------CRRELGPSLSTTHCSCCGAPRPSQEGWEGAA
A0A669PDH6_BCL2-01      AFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK-------
                         ::                  .     .        .     .       

A0A669PVQ4_BCL2A1-      -----
A0A669R428_MCL1-01      -----
A0A669P0Q7_BCL2L1-      CSAAF
A0A669PDH6_BCL2-01      -----
                             

© 1998-2020Legal notice