Dataset for protein BCL-2-like of organism Pelusios castaneus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                         *                                                      
-------s--nr---elvqdyi-ykLsqrgy-w----------p-lap--paaa-g-gsppa--g---------------
mahpgrr-yt--yvy-------s-m ql---s-sqsnnydpvs-t---ss----v-t-----pt-psstegvrpatligg
     mmgsey    yi ikflk i aekrndviglhiicgnrtefseplemssspnsadswhq                
      e nd            h        a aafeaeaegg a   ei    a g     gl                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
dpwgpngpsegaraligqepqegpraligspapspvagtprpdslcfpeeeldgcdpepermgpadgslpstppdeeddg
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                            .   .  .*  ... .       :      * :.  
-----------------------as----gaag--p--eglgpapva-vrqtLrragdefsrryrrafsqmlsqLhitpv
gpdglyqdslelisrylreaslp--prvs----nv-spphhsrvasrkallv cqvasgvqqknqitlqpltrt vlksg
                    ae gekplnallshsrrlgaae f qee hha  nt  flilehhed kgcsgk d  nf
                         hmgk    ep pg       a   ae   e     ek  e   ad  d      e

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      .  *    * ** .*****:::: **. :.    .   .   .    ::  :*  :      *:  : **  *.
tayrs-fvaVvtelFrDG-vNWGRIvtffsFGgvlcvesvsremevlvd---tiaywmTdylvthlreWiqnngGWesFv
edrqrivsq mnhv s  nt     lalim  aivskrlrnkrvsptinnkeslsvii tvitrnkhp lveqr  vr t
d lk   ik ae e a  i        i e   fma h qeinqqnceg   r  sf   nnd dn  ed    dg  
  ag     d                     a      dh   l      q       id  a    a     a  

       330       340       350       360       
....:....|....:....|....:....|....:....|....:..
     .                      :  :   .           
dlygvs---------e-fd-s---rrwlltlavvag---lgayl-r-
esfssnmlvnsrygr-v-nt-wvw-nvimsgstkpavlt-----t-k
cfcrnelaakhckeqpqlhlehsslktc lf l g lilslslmmh 
    ida       l a  f gii fl   g   cga     g  
© 1998-2022Legal notice