Dataset for protein BCL-2-like of organism Pelusios castaneus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C8RUG9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pelusios castaneus GN=MCL-1 (length=326 residues).
MLALKRNAVIGLNIYCGGGPALAPSSPASASGGGAPPAPTGPSSTEGVRPATLIGGDPWGPNGPSEGARALIGQEPQEGP
RALIGSPAPSPVAGTPRPDSLCFPEEELDGCDPEPERMGPADGSLPSTPPDEEDDGGPDGLYQDSLELISRYLREAAEPG
SKRLKGLLGEPRRPGGAGPAAVEKALETLRRVGDGVIQKHQIAFQGMLRKLDIKNEEDLKSVSAVATHVFSDGITNWGRI
VTLISFGAFVAKHLRSINQENCINTLAGIITDVLVTDKREWLVNQRGWEGFVDFFRVEDLEGSIRNVLMAFAGVAGLGAS
LAYMMR
>gnl|bcl2dbpro|A0A8C8S850_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Pelusios castaneus GN=BCL2L1 (length=229 residues).
MSNTNRELVIDFISYKLSQRGYSWSQFHAEDENRTEFAEEIEMASVPNGSPSWHQGASHMVNGAAGHSPSLEAHERFPAA
EVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMEVLVG
RIASWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAKSRKGQEQFNRWLLTGATVAGVLLLGSLLTRK
>gnl|bcl2dbpro|A0A8C8SUC3_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Pelusios castaneus GN=BCL2A1 (length=180 residues).
MESSEYRYVYYLVQDYLKYILQEPHLGPAPSRVAHVLRNTASFLQKENEETLKPCLDTLVITSVDAARRIFIKVMDEEFA
DGNTNWGRILTIFMFGGILSKRLQEHRVQLTEDNKEQISYFITDYIINNKAEWIEANGGWVSFTCSCSISLLVNHCYELE
ALHTSHVWRFLCLLLSVKPA
>gnl|bcl2dbpro|A0A8C8SWU7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Pelusios castaneus GN=BCL-2 (length=236 residues).
MAHPGRRGYDNREIVQKYIHYKLSQRGYDWAASENIAPVSPTLSPPLPAAAAGTSSDPAGLGSLPAEPPGSAAASNVPPG
EGLSPVPQAVHLTLCQAGDEFSRRYHRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
REMSPLVDSIAVWMTEYLNRHLHNWIQDNGGWDAFVELYGSNMRPVFDFSWISLKTILSLALVGACITLGAYLGHK
© 1998-2022Legal notice