Dataset for protein BCL-2-like of organism Pelusios castaneus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C8RUG9_MCL1-01      ------------------------MLALKRNAVIGLNIYCGGGPALAPSS
A0A8C8SUC3_BCL2A1-      -----MESSEYRYVYYLVQDYLKYILQE----------------------
A0A8C8S850_BCL2L1-      ------MSNTNR---ELVIDFISYKLSQRGYSWSQFHAEDENRTEFAEEI
A0A8C8SWU7_BCL2-01      MAHPGRRGYDNR---EIVQKYIHYKLSQRGYDWAASENIAPVSPTLSPPL
                                                 *                        

A0A8C8RUG9_MCL1-01      PASASGGGAPPAPTGPSSTEGVRPATLIGGDPWGPNGPSEGARALIGQEP
A0A8C8SUC3_BCL2A1-      --------------------------------------------------
A0A8C8S850_BCL2L1-      EMASVPNGSPSWHQG-----------------------------------
A0A8C8SWU7_BCL2-01      PAAAAGTSSDPAGLG-----------------------------------
                                                                          

A0A8C8RUG9_MCL1-01      QEGPRALIGSPAPSPVAGTPRPDSLCFPEEELDGCDPEPERMGPADGSLP
A0A8C8SUC3_BCL2A1-      --------------------------------------------------
A0A8C8S850_BCL2L1-      --------------------------------------------------
A0A8C8SWU7_BCL2-01      --------------------------------------------------
                                                                          

A0A8C8RUG9_MCL1-01      STPPDEEDDGGPDGLYQDSLELISRYLREAAEPGSKRLKGLLGEPRRPGG
A0A8C8SUC3_BCL2A1-      ------------------------------------------------PH
A0A8C8S850_BCL2L1-      ---------------------------------ASHMVNGAAGHSPSLEA
A0A8C8SWU7_BCL2-01      ------------------------------SLPAEPPGSAAASNVPPGEG
                                                                          

A0A8C8RUG9_MCL1-01      AGPAAVEKALETLRRVGDGVIQKHQIAFQGMLRKLDIKNEEDLKS-VSAV
A0A8C8SUC3_BCL2A1-      LGPAPSR-VAHVLRNTASFLQKENEETLKPCLDTLVITSVDAARRIFIKV
A0A8C8S850_BCL2L1-      HERFPAAEVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQS-FEQV
A0A8C8SWU7_BCL2-01      LSPVPQA-VHLTLCQAGDEFSRRYHRDFAQMSGQLHLTPFTARGR-FVAV
                            .   .  .*  ... .       :      * :.        .  *

A0A8C8RUG9_MCL1-01      ATHVFSDGITNWGRIVTLISFGAFVAKHLRSINQENCIN---TLAGIITD
A0A8C8SUC3_BCL2A1-      MDEEFADGNTNWGRILTIFMFGGILSKRLQEHRVQLTEDNKEQISYFITD
A0A8C8S850_BCL2L1-      VNELFRDG-VNWGRIVAFFSFGGALCVESVDKEMEVLVG---RIASWMTT
A0A8C8SWU7_BCL2-01      VEELFRDG-VNWGRIVAFFEFGGVMCVESVNREMSPLVD---SIAVWMTE
                            * ** .*****:::: **. :.    .   .   .    ::  :* 

A0A8C8RUG9_MCL1-01      VLVTDKREWLVNQRGWEGFVDFFRVE------------DLEGSIRNVLMA
A0A8C8SUC3_BCL2A1-      YIINNKAEWIEANGGWVSFTCSCSISLLVNHCYELEALHTSHVWRFLCLL
A0A8C8S850_BCL2L1-      YLTDHLDPWIQENGGWERFVDLYGNDAAAKSRKGQEQFN------RWLLT
A0A8C8SWU7_BCL2-01      YLNRHLHNWIQDNGGWDAFVELYGSNM-------RPVFDFSWISLKTILS
                         :      *:  : **  *.     .                      : 

A0A8C8RUG9_MCL1-01      FAGVAGLGASLAYMMR-
A0A8C8SUC3_BCL2A1-      LSVKPA-----------
A0A8C8S850_BCL2L1-      GATVAGVLLLGSLLTRK
A0A8C8SWU7_BCL2-01      LALVGACITLGAYLGHK
                         :   .           

© 1998-2022Legal notice