Dataset for protein BCL-2-like of organism Papio anubis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------fgdtrrlvadylgyklrqpg-----------------------------------------------------
mmmtdcs--ynye-aq-fvq-v-sikqyvwsqgstvpgnrtlategtasprrtpspgingtvsghtvhgagpggatprts
 aaapamap-i-ak--k-i-lcgq-g-gsc gfadpeeg le pdkeetemeeiggaefssqpwglpgssasrdpvgpst
  h gresys-g-irvgv-sc-a-e-laml           d g  a  agaa a   a npi   adpppvnal ahgr
     ptrqrkenalnalnl n ycr  gg                                      a   a    dag
      lgemf l  m   h   ga   e                                                   
         l     i            a                                                   
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                 .                                            *.
----------------g-----lhqalrragdeferryrrafsdmlsqlhvtp-gtarqsfeqvveelfrd--G-vnWGR
rlprpsappaavppvp-pgpspvsrvmqkvafsvqteveptlkpladn----siesrytryt--mnkv-sgsppiptl k
pvlatpvigtkamgreslaarkt--tptar-aglsknhaknvqacta-vnian dnevklvntmsd-elq-   vip   
sedtrgtkemepgdatatvsdv-rt-  sq kr rqmf tpapsysty dlk  fedqgglar --h- e     t    
  a  ep d      s at p kllg  q   p nllw sf dgirrk       d le  sl ava  -     e    
     a  a      l  p   akf   p   d  e e  d ae mgh          d                     
                       fe   e                                                   
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :.. :   :                                                   ::  .             
iVaffsFggalc------------------vesvnkemeplvdriae---wmaeylnthlrdWiqengGWd-tfvelygr
lptlvvleaiviesgpsvttwwslrstqprkkllrqriavdsstyqaisyfvvtfimrrtgpylrsqrtgeng-tk-f-p
sila levml renlpsadgkkp fp paheqernvqrqigqvks   s-ta--enn-ee  hqsa  alet--t-vn
 vit a t g                  l  kdidqysccqplvl   ll--v -d-ka-  vk    vk-drrprh-
     p   l a                     etg ls   ln i     issr v-th-t   d    g saiakpev
     e   f                         d      ee         d  agq ha   a      k   fm d
                                                                        a   a   
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-a------------------------fn---------------------------------------------tvagvvl
s-aeearrlrelrrvvekvsrkgqprg-fswlslrwlltlmqerlsrrwlqktadwgsvimsvsnsmrlslrtiwmtfnw
nmlasrkk kt qnegdgqqnnspep-q      gtfcsglpcpgpagfhe c aprppg lieekleadalsgfvscmt
gggta ea e         mgmrrtlrh      k v gva              ian             kl-ytrnlp
eder                  herg g                           a f             d vlhnhii
                         a d                                             ligaacg
                                                                         a c  ae
                                                                               d
                                                                               a

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
lgallsek------------------------------------------------------------------------
v-s-fg--lahlkqymsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrg
yt-yvvrsvslkllkgal                                                              
srpwitiqnkifhkcc                                                                
mngtaphme  a g                                                                  
f  k eal                                                                        
   g c                                                                          
     a                                                                          
                                                                                

       410       420       430       440      
....:....|....:....|....:....|....:....|....:.
                                              
----------------------------------------------
fpraryrarttnynssrsrfysgfnsrprgrvyrgrarvtswyssy
                                      agafflpr
                                           aik
                                              
                                              
                                              
                                              
                                              
© 1998-2020Legal notice