Dataset for protein BCL-2-like of organism Papio anubis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------lagdylsyvlrqrly--gag--ag-g-----------------------------------------
mmmadaaapatrrmvqlkrnakiglpg-vg---lg--e-gatppggrllateseeseprelllepepepepeeepprigg
 aatacefgynagafagrvqgpgsrnqlcwsyvgevesnapggaldygnglakpalareg                 rtf
  h prttadiye----fgg---qikhrsp qfsdp p rteagehtatrmgakstkins                 pra
    gpssysaepitvk---dfv---- qk   c     p dd d qespg tddpgtmf                    
     mmrqrs adlralihcca y   ec           a    a mea g  f  fd                    
      lge      m   a    e                                                       
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
spagtvpgptagasppaettpeprrvagppaigaivaffvfgaalcaesvnkemeplvgqvqewmvayletrvpdvtatp
gesahtihgpsvspqvqalseldglserdapd re                                     la wihss
pqpwpqvdvgpsrggtrreevdatpfvpgmga pl                                            r
ndl all sa  ndasghsqss e etie nw  a                                             
  g  g       a q f     a aq a  v                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                              .  :             *                
-gp---aikrrlreage-eakrlrrlfspvekqmnvt--pgtarpvfmqvveklfrd--ginwGri---------vaffs
e--epe---avvqrvedsvqekykenqnemlsnlhmsppilnkgqsvnsimnemea-grs-yv nvdygataeeleth-h
prlllskvt-taapmafrferevekimkdlvelvgyesendgrytlilplev----gav-vl  esgnspstd  ---v-
adwgffvtsqawkkl lmpspahdaalrgetd-d-ia   fsdvkrletmldhvls spipt   l          slia
ssavsrpphl-m st aelrtnanttwqacsrs-d-y   ed qga ar s ae e   t                 i v
l  tap llem  q   g  qlf sr a yrpk atk       e  tl a    q   p                   t
g  a d a     a   d  lg   f   pag   lh                                        e
                         d     a                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                      :                    .                    
fggslc------------------vesvdkemvrtsleiaewmarylqtklipwiqnnggwdt-----------fvrlyg
gc-avnrvtilcdkfsghpsgfpylrfsedpsyvlvsrldaslfegrnihvrdkrtqrrsissgfvkkfepksgtregfp
--a---kklp vtawgslrktpapikernanlqpqykavsyfyttfqarntketlrmqp gan           wdkfle
 e imiere      wkk  fq rahqeirddeddiqq islvlseimngagt kpeg   vk           sttaph
 a v l                  k lqti vssccgp vl ivdv vdtkea  vss   gg            mntm 
   t a                     k g qa   en q   sar egrhh   hk    ee            hah  
   f                                d            q a    d     a                 
                                                        a                       

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
raryrastv-rnssr-------------------------------------------------------------v-rg
vna--errtnyerf-srfysgfnsrpdikneddvkslsrvmvhvpsrgvtrwgrivtlislgktvdphlptmnrgr-y--
tl-rv--gkqqpkgtaswlqswlrkv                 lfcd prn    lsagffeafaakgfkgilwsssltw
ngmlage--g-lhenmglfl mvqgl                                               vrncrlv
p-galvdsrslkgqyha    l ce                                                qqk ikt
mtdkicamllh lnkf                                                         ie  aep
ds ge    a   kdc                                                         ha   al
 e                                                                             a

       410       420       430       440       450       460 
....:....|....:....|....:....|....:....|....:....|....:....|.
                                                             
fara---------gswys-k-----------------------------------------
rl--mtvgavvtlt-lf-p-rgwdgfveffhvedleggirnvllafagvagvsnklaylir
l-tgiwsagnilv-l--ary                               igagi l   
-tgvalmvllrfnraylvsr                                         
scstvilsfc  kpdfplqq                                         
  escgd        a gkl                                         
  dl a            i                                          
   c              h                                          
© 1998-2022Legal notice