Dataset for protein BCL-2-like of organism Papio anubis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                     :.                              *      : .                 
-------------------r-mfglkrnaviglnlycg-----------gaglGagsggatpp-grll------------
tveslrgrtmadplrertn-elvadylgykl-q-g-vcsqfsdveenrtarep tpeprpstsg----atekeasarrei
        mahtgrtsyde ailvkfvs---s-k- sw           e pe --tepeadapains            
           a asgqst    m  ih   r r  e            d  d  e  m       fg            
              map                                      a                        
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
gggeagtviggsagasppaaltpdarrvarpppigaevpdvtatparplffaptrraapleemeapaadaimspeeeldg
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------------atgakdtkpmgrsgatsrk
yepeplgkrpavlpllelvgesgnspstdgslpstpppaeeeedelyrqsleiiswylreq-------------------
                                                             sqswhtvhspavrdpvght
                                                             nppg lpd a sn   a s
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                          .:* ..     .    .  :              .  :   :: .    .***:
-----------------------aletlRragdgvqrrhrtafqgmlskldikpgddvkslsrvmvhvfsdg-gtnWGRi
sslptrevppmaagpalspvppvvhqvm sva--f-anyerlhsslfrqyhgtnetayqrfaqmveellrg-pvpt   v
 p dapaaiaa            eaaa  q   e-et l qt rdftaa rvy fnrrelvtl ana  q s  v    l
                       lkl   e   d sl f  d ae s    l   s qg  et sd              
                             a                a                                 
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*::. *.. :              .      : .  :      :.  *          *:  . **              
VtlisFgafv--------------akhlktkeqescveplaesitdvLvrtlrd----WlvkqgGWdgfveffgv-----
 afft agtllereplvtawwkkrcvesvninmspliaricqwmvay ssrkagqhra iqanr  attcslyvsedleg
 vv   am              sfqprlr  qgd sqdqlrlatl nth ht      hss   gk thssr-yasve
    e   v                a   d     gnv a    ed  ep       e     i  aplhpssaad
                                     d                       d     e      nnm   
                                                                   a      eg    
                                                                          d     

       410       420       430         
....:....|....:....|....:....|....:....
                                       
--------------rkvllqaalvaglvt-gayl-r---
srkgrfrlafwwsv-nl-iaffgaclvgal----w-kll
gi  pppfnnsalsl--i----tmgaiasglglfitr  
an  qlleg     htwfttqvrl icwlafsf ss   
     e  d      rt sslmfi e igv    gh   
               ee  hgga    h      a    
                   g                   
© 1998-2023Legal notice