Dataset for protein BCL-2-like of organism Papio anubis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             :    :   *   .                                                     
-----mfglkrnav----iglnLycggaglgagsggatppggrll------------gggeagtviggsagasppaaltp
mamagrtryrtrrlvmkylhyy sqray-----------------atekeasarrei-----------------------
  h dpl edneei     adk g c rewd  d a                      aap pgifssqp ht hp asr
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
d----------------------------ptrraapleemeapaada------------------rpavlpllelvg---
-arrvarpppigaevpdvtatparplffa------------------imspeeeldgyepeplgk------------esg
                              va ts  ptpa    a                   g  ls vppv h   
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                             **.    . * .   :   
--------------------------------------atgakdtkpmgrsgatsrkaletLRrvgdgvqRnhetafqgm
nspstdgslpstpppaeeeedelyrqsleiiswylreq---------------------lr  q----ls syrsdyrey
                                      ep tpepr stpea vl s aa    a  dfh rffr  a  
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              .: :   :: *.   .***:*::. *.. :            .  .:                :. 
lrkldikneddvkslsrvmvhvfsDgv-tnWGRiVtlisFgafvakhlktin---qesciep---------------lae
-------pgtrrgrvatmveellr spg-t   v sfvt agvmlvrsvnvtawwmsrsvqnrlkeqegdvardcqrivl
ssq hlt fna elf l a a       p      fe   tlceeeplre   kkplfd                  a
                                                                                
                                                                                

       330       340       350       360       370       380     
....:....|....:....|....:....|....:....|....:....|....:....|....:
 ::. *    . *:  : **                                    :        
sitdvLvrtkrdWlvkqrGWdgf----veffrvefleggirn-ll------g-gaglaylwr---
wmssy ngqlht iqdng  gktcssyg---h--d-----s-v--afagva-v--tmgiyigrll
ler a hh a   a    ai vepscpys-sp-plsww-lltiqslllvllqtriceilthk 
                     a   ll hsmsplsnhefl kk  lafaac aciff a hs   
                                 d dfae  h           aga         
© 1998-2022Legal notice