Dataset for protein BCL-2-like of organism Papio anubis

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A096MPU7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Papio anubis GN=BCL-2 (length=238 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDGAATPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLPTPAAPAAA
AGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVES
VNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A096MRS6_MCL1-04 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Papio anubis GN=MCL-1 (length=343 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPP
PIGAEVPDVTATPARPLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSL
PSTPPPAEEEEDELYRQSLEIISWYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWAIFCSSSV
EYSSVDSNHEEISHQGRIAEIHS
>gnl|bcl2dbpro|A0A096MRS6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Papio anubis GN=MCL-1 (length=327 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPP
PIGAEVPDVTATPARPLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSL
PSTPPPAEEEEDELYRQSLEIISWYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWGKTCSPLV
FMCILWG
>gnl|bcl2dbpro|A0A096MRS6_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Papio anubis GN=MCL-1 (length=197 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A096MRS6_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Papio anubis GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPP
PIGAEVPDVTATPARPLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSL
PSTPPPAEEEEDELYRQSLEIISWYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A096NM44_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Papio anubis GN=BCL2L10 (length=194 residues).
MADPLRERTERLLADYLGCCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSAYRGYPGNRVELVALMAEAVLSDSP
GPTWGRVVSLVTFAGTLLEREPLVTAWWKKRSFQPRLKEQEGDVARDCQRLVALLSSRLAGQHRAWLQAQGGWDGFCHFF
RSPFPLAFWRKLLIQAFLACLLATAFGYLWTRLL
© 1998-2022Legal notice