Dataset for protein BCL-2-like of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A096MRS6_MCL1-03      -----MFGLKRNAV----IGLNLYCGGAGLGAGSGGATPPGGRLL-----
A0A096NM44_BCL2L10      --MADPLRERTERL----LADYLGCCAR----------------------
A0A096MPU7_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDGAATP-----------
A0A096MRS6_MCL1-01      -----MFGLKRNAV----IGLNLYCGGAGLGAGSGGATPPGGRLLATEKE
A0A096MRS6_MCL1-04      -----MFGLKRNAV----IGLNLYCGGAGLGAGSGGATPPGGRLLATEKE
A0A096MRS6_MCL1-02      -----MFGLKRNAV----IGLNLYCGGAGLGAGSGGATPPGGRLLATEKE
                                     :    :   *   .                       

A0A096MRS6_MCL1-03      --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A096MPU7_BCL2-01      -------GAAPAPGIFSSQPGHTPHPAASRD-------------------
A0A096MRS6_MCL1-01      ASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTA
A0A096MRS6_MCL1-04      ASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTA
A0A096MRS6_MCL1-02      ASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTA
                                                                          

A0A096MRS6_MCL1-03      --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A096MPU7_BCL2-01      ---------PVARTSPLPTPAAPAAAA------------------GPALS
A0A096MRS6_MCL1-01      TPARPLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVL
A0A096MRS6_MCL1-04      TPARPLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVL
A0A096MRS6_MCL1-02      TPARPLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVL
                                                                          

A0A096MRS6_MCL1-03      ------------------------------------------------AT
A0A096NM44_BCL2L10      ------------------------------------------------EP
A0A096MPU7_BCL2-01      PVPPVVH-------------------------------------------
A0A096MRS6_MCL1-01      PLLELVGESGNSPSTDGSLPSTPPPAEEEEDELYRQSLEIISWYLREQAT
A0A096MRS6_MCL1-04      PLLELVGESGNSPSTDGSLPSTPPPAEEEEDELYRQSLEIISWYLREQAT
A0A096MRS6_MCL1-02      PLLELVGESGNSPSTDGSLPSTPPPAEEEEDELYRQSLEIISWYLREQAT
                                                                          

A0A096MRS6_MCL1-03      GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
A0A096NM44_BCL2L10      GTPEPRPSTPEAAVLRSAAARLRQ----LHRSFFSAYRGY-------PGN
A0A096MPU7_BCL2-01      -------------------LTLRQAGDDFSRRYRRDFAEMSSQLHLTPFT
A0A096MRS6_MCL1-01      GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
A0A096MRS6_MCL1-04      GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
A0A096MRS6_MCL1-02      GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
                                             **.    . * .   :             

A0A096MRS6_MCL1-03      DVKSLSRVMVHVFSDGV-TNWGRIVTLISFGAFVAKHLKTIN---QESCI
A0A096NM44_BCL2L10      RVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREPLVTAWWKKRSF
A0A096MPU7_BCL2-01      ARGRFATVVEELFRDGV--NWGRIVAFFEFGGVMCVESVNRE---MSPLV
A0A096MRS6_MCL1-01      DVKSLSRVMVHVFSDGV-TNWGRIVTLISFGAFVAKHLKTIN---QESCI
A0A096MRS6_MCL1-04      DVKSLSRVMVHVFSDGV-TNWGRIVTLISFGAFVAKHLKTIN---QESCI
A0A096MRS6_MCL1-02      DVKSLSRVMVHVFSDGV-TNWGRIVTLISFGAFVAKHLKTIN---QESCI
                            .: :   :: *.   .***:*::. *.. :            .  .

A0A096MRS6_MCL1-03      EP---------------LAESITDVLVRTKRDWLVKQRGWDGF----VEF
A0A096NM44_BCL2L10      QPRLKEQEGDVARDCQRLVALLSSRLAGQHRAWLQAQGGWDGF----CHF
A0A096MPU7_BCL2-01      DN---------------IALWMTEYLNRHLHTWIQDNGGWDAFVELYGPS
A0A096MRS6_MCL1-01      EP---------------LAESITDVLVRTKRDWLVKQRGWGKTCSPLV--
A0A096MRS6_MCL1-04      EP---------------LAESITDVLVRTKRDWLVKQRGWAIFCSSSVEY
A0A096MRS6_MCL1-02      EP---------------LAESITDVLVRTKRDWLVKQRGWDGF----VEF
                        :                :.  ::. *    . *:  : **          

A0A096MRS6_MCL1-03      FHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR---
A0A096NM44_BCL2L10      FRSPFPLAFWRKLLIQAFLACLLATAFGYLWTRLL
A0A096MPU7_BCL2-01      MRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK-
A0A096MRS6_MCL1-01      -------------------------FMCILWG---
A0A096MRS6_MCL1-04      SSVDSNHEEISH-----------QGRIAEIHS---
A0A096MRS6_MCL1-02      FHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR---
                                                  :        

© 1998-2022Legal notice