Dataset for protein BCL-2-like of organism Papio anubis

[Download (right click)] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A096MRS6_MCL1-01         ---------MFG------LKRNAVIGLN---LYCGGAGLGAGSGGAT-PP
A0A096MRS6_MCL1-04         ---------MFG------LKRNAVIGLN---LYCGGAGLGAGSGGAT-PP
A0A096MRS6_MCL1-02         ---------MFG------LKRNAVIGLN---LYCGGAGLGAGSGGAT-PP
A0A096MPU7_BCL2-01         ---------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDGAAT-PG
A0A8I5MVB8_BCL2L1-01       ---------MSQ------SNRELVVDFLSYKLSQKGYSWSQFSDVEENRT
A0A2I3MUE4_BCL2L2-01       ---------MATPA-SAPDTRALVADFVGYKLRQKGYVCGAGPG------
A0A8I5NQD2_BCL2L10-01      TVESLRGRTMADPL-RE-RTERLLADYLGCCAREPGT-------------
A0A096MRS6_MCL1-03         ---------MFG------LKRNAVIGLN---LYCGGAGLGAGSGGAT-PP
A0A096NM44_BCL2L10-01      ---------MADPL-RE-RTERLLADYLGCCAREPGT-------------
                                    *         ..  :           *              

A0A096MRS6_MCL1-01         GGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPPP
A0A096MRS6_MCL1-04         GGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPPP
A0A096MRS6_MCL1-02         GGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPPP
A0A096MPU7_BCL2-01         A--------------------------------------------APAPG
A0A8I5MVB8_BCL2L1-01       E--------------------------------------------APE-G
A0A2I3MUE4_BCL2L2-01       --------------------------------------------------
A0A8I5NQD2_BCL2L10-01      --------------------------------------------------
A0A096MRS6_MCL1-03         GGRLLA--------------------------------------------
A0A096NM44_BCL2L10-01      --------------------------------------------------
                                                                             

A0A096MRS6_MCL1-01         IGAEVPDVTATPARPLFFAPTRR--AAPLEEMEAPAADAIMSPEEELDGY
A0A096MRS6_MCL1-04         IGAEVPDVTATPARPLFFAPTRR--AAPLEEMEAPAADAIMSPEEELDGY
A0A096MRS6_MCL1-02         IGAEVPDVTATPARPLFFAPTRR--AAPLEEMEAPAADAIMSPEEELDGY
A0A096MPU7_BCL2-01         IFSSQPGHTPHPAAS--RDPVAR--TSPLPTPAAPAAAA-----------
A0A8I5MVB8_BCL2L1-01       TES-E-METPS-AIN--GNPSWHLVDSPAVNGATGHSSS-----------
A0A2I3MUE4_BCL2L2-01       --------------------------------------------------
A0A8I5NQD2_BCL2L10-01      ---------------------------PEPRPST----------------
A0A096MRS6_MCL1-03         --------------------------------------------------
A0A096NM44_BCL2L10-01      ---------------------------PEPRPST----------------
                                                                             

A0A096MRS6_MCL1-01         EPEPLGKRPAVLPLLELVGESGNSPSTDGSLPSTPPPAEEEEDELYRQSL
A0A096MRS6_MCL1-04         EPEPLGKRPAVLPLLELVGESGNSPSTDGSLPSTPPPAEEEEDELYRQSL
A0A096MRS6_MCL1-02         EPEPLGKRPAVLPLLELVGESGNSPSTDGSLPSTPPPAEEEEDELYRQSL
A0A096MPU7_BCL2-01         --------------------------GPA---------------------
A0A8I5MVB8_BCL2L1-01       --------------------------LDA---------------------
A0A2I3MUE4_BCL2L2-01       --------------------------------------------------
A0A8I5NQD2_BCL2L10-01      --------------------------------------------------
A0A096MRS6_MCL1-03         --------------------------------------------------
A0A096NM44_BCL2L10-01      --------------------------------------------------
                                                                             

A0A096MRS6_MCL1-01         EIISWYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQ
A0A096MRS6_MCL1-04         EIISWYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQ
A0A096MRS6_MCL1-02         EIISWYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQ
A0A096MPU7_BCL2-01         --------------LSPVP--------PVVHLTLRQAGDDFSRRYRRDFA
A0A8I5MVB8_BCL2L1-01       --------------REVIPM-------AAVKQALREAGDEFELRYRRAFS
A0A2I3MUE4_BCL2L2-01       --------------EGPAA--------DPLHQAMRAAGDEFETRFRRTFS
A0A8I5NQD2_BCL2L10-01      ----------------------------PEAAVLRSAAARLRQLHRSFFS
A0A096MRS6_MCL1-03         -----------TGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQ
A0A096NM44_BCL2L10-01      ----------------------------PEAAVLRSAAARLRQLHRSFFS
                                                           .:* ..  .   ..  * 

A0A096MRS6_MCL1-01         GMLRKLDIKNEDDVKSLSRVMVHVFS--DGVTNWGRIVTLISFGAFVAKH
A0A096MRS6_MCL1-04         GMLRKLDIKNEDDVKSLSRVMVHVFS--DGVTNWGRIVTLISFGAFVAKH
A0A096MRS6_MCL1-02         GMLRKLDIKNEDDVKSLSRVMVHVFS--DGVTNWGRIVTLISFGAFVAKH
A0A096MPU7_BCL2-01         EMSSQLHLTPFTARGRFATVVEELFR--DGV-NWGRIVAFFEFGGVMCV-
A0A8I5MVB8_BCL2L1-01       DLTSQLHITPGTAYQSFEQVVNELFR--DGV-NWGRIVAFFSFGGALCV-
A0A2I3MUE4_BCL2L2-01       DLAAQLHVTPGSAQQRFTQVSDELFQ--GGP-NWGRLVAFFVFGAALCA-
A0A8I5NQD2_BCL2L10-01      ----AYRGYPGNRVELVALMAEAVLSDSPGP-TWGRVVSLVTFAGTLLE-
A0A096MRS6_MCL1-03         GMLRKLDIKNEDDVKSLSRVMVHVFS--DGVTNWGRIVTLISFGAFVAKH
A0A096NM44_BCL2L10-01      ----AYRGYPGNRVELVALMAEAVLSDSPGP-TWGRVVSLVTFAGTLLE-
                                           .  :   ::    *  .***:*::. *.. :   

A0A096MRS6_MCL1-01         LKT--------------INQE--SCIE----PLAESITDVLVRTKRDWLV
A0A096MRS6_MCL1-04         LKT--------------INQE--SCIE----PLAESITDVLVRTKRDWLV
A0A096MRS6_MCL1-02         LKT--------------INQE--SCIE----PLAESITDVLVRTKRDWLV
A0A096MPU7_BCL2-01         -ES--------------VNREMSPLVD----NIALWMTEYLNRHLHTWIQ
A0A8I5MVB8_BCL2L1-01       -ES--------------VDKEMQVLVS----RIAAWMATYLNDHLEPWIQ
A0A2I3MUE4_BCL2L2-01       -ES--------------VNKEMEPLVG----QVQEWMVAYLETRLADWIH
A0A8I5NQD2_BCL2L10-01      -REPLVTAWWKKRSFQPRLKEQEGDVARDCQRLVALLSSRLAGQHRAWLQ
A0A096MRS6_MCL1-03         LKT--------------INQE--SCIE----PLAESITDVLVRTKRDWLV
A0A096NM44_BCL2L10-01      -REPLVTAWWKKRSFQPRLKEQEGDVARDCQRLVALLSSRLAGQHRAWLQ
                            .                 :*    :      :   :   *      *: 

A0A096MRS6_MCL1-01         KQRGWGKTCSPLV-------------------------------------
A0A096MRS6_MCL1-04         KQRGWAIFCSSSVEYSSVDSNH----E-E----ISH-------------Q
A0A096MRS6_MCL1-02         KQRGWDGFVEF----FHVEDLE----G-G----IRNVLLAFAG-VAGV-G
A0A096MPU7_BCL2-01         DNGGWDAFVEL----YGPSM----RPLFDFSWLSLKTLLSLAL-VGACIT
A0A8I5MVB8_BCL2L1-01       ENGGWDTFVEL----YGNNAAAESRKGQE---RFNRWFLTGMT-VAGVVL
A0A2I3MUE4_BCL2L2-01       SSGGWAEFTAL----YGDGALEEARRLREGNWASVRTVLTGAVALGALVT
A0A8I5NQD2_BCL2L10-01      AQGGWDGFCHF----FRSPF-----PLAFWRKLLIQAFLACLL-AT---A
A0A096MRS6_MCL1-03         KQRGWDGFVEF----FHVEDLE----G-G----IRNVLLAFAG-VAGV-G
A0A096NM44_BCL2L10-01      AQGGWDGFCHF----FRSPF-----PLAFWRKLLIQAFLACLL-AT---A
                            . **                                             

A0A096MRS6_MCL1-01         -FMCILW-G
A0A096MRS6_MCL1-04         GRIAEIH-S
A0A096MRS6_MCL1-02         AGLAYLI-R
A0A096MPU7_BCL2-01         LGAYLGH-K
A0A8I5MVB8_BCL2L1-01       LGSLFSR-K
A0A2I3MUE4_BCL2L2-01       VGAFFAS-K
A0A8I5NQD2_BCL2L10-01      FGYLWTRLL
A0A096MRS6_MCL1-03         AGLAYLI-R
A0A096NM44_BCL2L10-01      FGYLWTRLL
                                    

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice