Dataset for protein BCL-2-like of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A096NMX5_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQIP------------------------
A0A096NMX5_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQIP------------------------
A0A096NM44_BCL2L10      --MADPLRERTERLLADYLGCCAREPG-----------------------
A0A096NV05_BCL2L1-      ----------------------------MW--------------------
A0A096MPU7_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-----------DAGDGAATP
A0A096NV05_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
A0A096MRS6_MCL1-03      -------------MFGLKRNAVIGLNLY----------------------
A0A096NX09_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGY----------------------
A0A096MRS6_MCL1-01      -------------MFGLKRNAVIGLNLY----------------------
A0A096MRS6_MCL1-02      -------------MFGLKRNAVIGLNLY----------------------
A0A096NX09_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGY----------------------
A0A096NX09_BCL2L2-      -MAAAAAAAAAAGAAGGRGSGPGRRRHL----------------------
A0A096NX09_BCL2L2-      -MAAAAAAAAAAGAAGGRGSGPGRRRHL----------------------
                                                                          

A0A096NMX5_BCL2A1-      ------------------------------------QPGLGPSKTSRVLQ
A0A096NMX5_BCL2A1-      ------------------------------------QPGLGPSKTSRVLQ
A0A096NM44_BCL2L10      -----------------------------TPEPRPSTPEAAV--------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A096MPU7_BCL2-01      GAAPAPGIFSSQPGHTPHPAASRDPVARTSPLPTPAAPAAAAGPALSPVP
A0A096NV05_BCL2L1-      METPS-AINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAA--------
A0A096MRS6_MCL1-03      ------------------------------------CGGAGLGAGSGGAT
A0A096NX09_BCL2L2-      ------------------------------------VCGAG--PGEGPAA
A0A096MRS6_MCL1-01      ------------------------------------CGGAGLGAGSGGAT
A0A096MRS6_MCL1-02      ------------------------------------CGGAGLGAGSGGAT
A0A096NX09_BCL2L2-      ------------------------------------VCGAG--PGEGPAA
A0A096NX09_BCL2L2-      ------------------------------------VPGAGGEAGEGAPG
A0A096NX09_BCL2L2-      ------------------------------------VPGAGGEAGEGAPG
                                                                          

A0A096NMX5_BCL2A1-      KVAFSVQKEVEKNLKPCL-----------------------DNVNVASID
A0A096NMX5_BCL2A1-      KVAFSVQKEVEKNLKPCL-----------------------DNVNVASID
A0A096NM44_BCL2L10      ------LRSAAARLRQLH----------------RSFFSAYRGY----PG
A0A096NV05_BCL2L1-      --KRTGLRPQ-KGLNRRW----------------RPPVPSMATH----PG
A0A096MPU7_BCL2-01      PVVHLTLRQAGDDFSRRY----------------RRDFAEMSSQLHLTPF
A0A096NV05_BCL2L1-      --VKQALREAGDEFELRY----------------RRAFSDLTSQLHITPG
A0A096MRS6_MCL1-03      PPGGRLLAT-----------------------------------------
A0A096NX09_BCL2L2-      DPLHQAMRAAGDEFETRF----------------RRTFSDLAAQLHVTPG
A0A096MRS6_MCL1-01      PPGGRLLATEKEASARRE-----------------IGGGEAGTVIGGTAG
A0A096MRS6_MCL1-02      PPGGRLLATEKEASARRE-----------------IGGGEAGTVIGGTAG
A0A096NX09_BCL2L2-      DPLHQAMRAAGDEFETRF----------------RRTFSDLAAQLHVTPG
A0A096NX09_BCL2L2-      GAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSG
A0A096NX09_BCL2L2-      GAGDYGNGLESEELEPED--------------------------------
                                                                          

A0A096NMX5_BCL2A1-      TARTLFNQVMEKEFEDG-IINWGRIVTIFAFEGILIKKL-----------
A0A096NMX5_BCL2A1-      TARTLFNQVMEKEFEDG-IINWGRIVTIFAFEGILIKKL-----------
A0A096NM44_BCL2L10      NRVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREPLVTAWWKKRS
A0A096NV05_BCL2L1-      TAYQSFEQVVNELFRD--GVNWGRIVAFFSFGGALC--------------
A0A096MPU7_BCL2-01      TARGRFATVVEELFRD--GVNWGRIVAFFEFGGVMC--------------
A0A096NV05_BCL2L1-      TAYQSFEQVVNELFRD--GVNWGRIVAFFSFGGALC--------------
A0A096MRS6_MCL1-03      --------------------------------------------------
A0A096NX09_BCL2L2-      SAQQRFTQVSDELFQG--GPNWGRLVAFFVFGAALC--------------
A0A096MRS6_MCL1-01      ASPPAALTPDARRVAR--PPPIGAE-------------------------
A0A096MRS6_MCL1-02      ASPPAALTPDARRVAR--PPPIGAE-------------------------
A0A096NX09_BCL2L2-      SAQQRFTQVSDELFQG--GPNWGRLVAFFVFGAALC--------------
A0A096NX09_BCL2L2-      APGSQEEEEEPGLVEG--DPGDGAI-------------------------
A0A096NX09_BCL2L2-      ----QEEEEEPGLVEG--DPGDGAI-------------------------
                                                                          

A0A096NMX5_BCL2A1-      ----LRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGK-------
A0A096NMX5_BCL2A1-      ----LRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVK---
A0A096NM44_BCL2L10      FQPRLKEQEGDVARDCQRLVALLSSRLAGQHRAWLQAQGGWVSTRRTPGR
A0A096NV05_BCL2L1-      ----VESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGN
A0A096MPU7_BCL2-01      ----VESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGP
A0A096NV05_BCL2L1-      ----VESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGN
A0A096MRS6_MCL1-03      --------------------------------------------------
A0A096NX09_BCL2L2-      ----AESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGD
A0A096MRS6_MCL1-01      ------------------------------VPDVTATPARPLFFAPTRRA
A0A096MRS6_MCL1-02      ------------------------------VPDVTATPARPLFFAPTRRA
A0A096NX09_BCL2L2-      ----AESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARV
A0A096NX09_BCL2L2-      --------------------------------------EDPELEAIKARV
A0A096NX09_BCL2L2-      --------------------------------------EDPELEAIKARV
                                                                          

A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NM44_BCL2L10      GAGRA---------------------------------------------
A0A096NV05_BCL2L1-      NAAAE---------------------------------------------
A0A096MPU7_BCL2-01      SM------------------------------------------------
A0A096NV05_BCL2L1-      NAAAE---------------------------------------------
A0A096MRS6_MCL1-03      --------------------------------------------------
A0A096NX09_BCL2L2-      GALEE-----------------------------ARRLREGNWASVRTVL
A0A096MRS6_MCL1-01      APLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLE---------L
A0A096MRS6_MCL1-02      APLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLE---------L
A0A096NX09_BCL2L2-      REMEE-EAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIY
A0A096NX09_BCL2L2-      REMEE-EAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIY
A0A096NX09_BCL2L2-      REMEE-EAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIY
                                                                          

A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      -------------------------------------------KFEPKSG
A0A096NM44_BCL2L10      -------------------------------------------SGKRPRG
A0A096NV05_BCL2L1-      -------------------------------------------SRKGQER
A0A096MPU7_BCL2-01      -----------------------------------------------RPL
A0A096NV05_BCL2L1-      -------------------------------------------SRKGQER
A0A096MRS6_MCL1-03      --------------------------------------------------
A0A096NX09_BCL2L2-      TGAVALGALVTV--------------------------------------
A0A096MRS6_MCL1-01      VGESGNSPSTD----------------------GSLPSTPPPAEEEEDEL
A0A096MRS6_MCL1-02      VGESGNSPSTD----------------------GSLPSTPPPAEEEEDEL
A0A096NX09_BCL2L2-      VGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKES
A0A096NX09_BCL2L2-      VGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKES
A0A096NX09_BCL2L2-      VGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKES
                                                                          

A0A096NMX5_BCL2A1-      WHNHMPM---LVESVAHKKKKMAL--------------------------
A0A096NMX5_BCL2A1-      WMTFLEVTGKICEMLSLLKQYC----------------------------
A0A096NM44_BCL2L10      RH------GWLLSLLQEPLSAGFLEKTADPGFPGMLVSNSLRLSLDTIIM
A0A096NV05_BCL2L1-      FN------RWFLTGM--------------------------------TVA
A0A096MPU7_BCL2-01      FDFSWLSLKTLLSLA--------------------------------LVG
A0A096NV05_BCL2L1-      FN------RWFLTGM--------------------------------TVA
A0A096MRS6_MCL1-03      -----------------GAKDTKPMGRSGATSRKALETLRRVGDGVQRNH
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A096MRS6_MCL1-01      YRQSLEIISWYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNH
A0A096MRS6_MCL1-02      YRQSLEIISWYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNH
A0A096NX09_BCL2L2-      VRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNS
A0A096NX09_BCL2L2-      VRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNS
A0A096NX09_BCL2L2-      VRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNS
                                                                          

A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NM44_BCL2L10      SFNIFNPLLPAQL-------------------------------------
A0A096NV05_BCL2L1-      GVVLLGSLFSRK--------------------------------------
A0A096MPU7_BCL2-01      ACITLGAYLGHK--------------------------------------
A0A096NV05_BCL2L1-      GVVLLGSLFSRK--------------------------------------
A0A096MRS6_MCL1-03      ETA--FQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A096MRS6_MCL1-01      ETA--FQGWVCGV-----------------LPCRGPRRW-----------
A0A096MRS6_MCL1-02      ETA--FQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGA
A0A096NX09_BCL2L2-      SRSRFYSGFNSRP-------------------------------------
A0A096NX09_BCL2L2-      SRSRFYSGFNSRP-------------------------------------
A0A096NX09_BCL2L2-      SRSRFYSGFNSRP-------------------------------------
                                                                          

A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A096MPU7_BCL2-01      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A096MRS6_MCL1-03      FVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVE
A0A096NX09_BCL2L2-      ------------------------------GAFFASK-------------
A0A096MRS6_MCL1-01      ----------HQKCAAGFCRCCWS------RSWF----------------
A0A096MRS6_MCL1-02      FVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVE
A0A096NX09_BCL2L2-      ----------RGRVYRGRARA---------TSWYSPY-------------
A0A096NX09_BCL2L2-      ----------RGRVYRGRARA---------TSWYSPY-------------
A0A096NX09_BCL2L2-      ----------RGRVYRGRARA---------TSWYSPY-------------
                                                                          

A0A096NMX5_BCL2A1-      ----------------------------
A0A096NMX5_BCL2A1-      ----------------------------
A0A096NM44_BCL2L10      ----------------------------
A0A096NV05_BCL2L1-      ----------------------------
A0A096MPU7_BCL2-01      ----------------------------
A0A096NV05_BCL2L1-      ----------------------------
A0A096MRS6_MCL1-03      DLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A096NX09_BCL2L2-      ----------------------------
A0A096MRS6_MCL1-01      -----------------GISNKIALL--
A0A096MRS6_MCL1-02      DLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A096NX09_BCL2L2-      ----------------------------
A0A096NX09_BCL2L2-      ----------------------------
A0A096NX09_BCL2L2-      ----------------------------
                                                    

© 1998-2021Legal notice