Dataset for protein BCL-2-like of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A096NV05_BCL2L1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQIPQ-----------------------
A0A096NMX5_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQIPQ-----------------------
A0A096NX09_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKG-----------------------
A0A2I3LFM0_MCL1-03      ---------MFGLKRNAVIGLNLYCGG-----------------------
A0A096NX09_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYV---------------------
A0A2I3LFM0_MCL1-01      -----MFGLKRNAVIGLNLYCGGAGLG------------------AGSGG
A0A096NM44_BCL2L10      --MADPLRERTERLLADYLGCCAREPG-----------------------
A0A096MPU7_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-----------DAGDGAATP
A0A096NV05_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
                                                                          

A0A096NV05_BCL2L1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      ---------------PGLGPSKT---------------------------
A0A096NMX5_BCL2A1-      ---------------PGLGPSKT---------------------------
A0A096NX09_BCL2L2-      ---------------YVCGAGPG----------------------EGPAA
A0A2I3LFM0_MCL1-03      ---------------AGLGAGSGGATPPGGRLLATGAKDTKPMGRSGATS
A0A096NX09_BCL2L2-      ---------------------------------------CGAGPGEGPAA
A0A2I3LFM0_MCL1-01      ATPPGGRLLATEKEASARREIGGGEAGTVIGGTAGASPPAALTPDARRVA
A0A096NM44_BCL2L10      -----------------------------TPEPRPSTPEAAV--------
A0A096MPU7_BCL2-01      GAAPAPGIFSSQPGHTPHPAASRDPVARTSPLPTPAAPAAAAGPALSPVP
A0A096NV05_BCL2L1-      METPS-AINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAA--------
                                                                          

A0A096NV05_BCL2L1-      -----MWKRTGLRPQKGLNRRWRPPVPSMATHPGTAYQS-FEQVV-NELF
A0A096NMX5_BCL2A1-      ---SRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVM-EKEF
A0A096NMX5_BCL2A1-      ---SRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVM-EKEF
A0A096NX09_BCL2L2-      DPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQR-FTQVS-DELF
A0A2I3LFM0_MCL1-03      RKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-LSRVM-VHVF
A0A096NX09_BCL2L2-      DPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQR-FTQVS-DELF
A0A2I3LFM0_MCL1-01      RPPPIGAEVPDVTATPARPLFFAPTRRAAPLEEMEAPAA-DAIMSPEEEL
A0A096NM44_BCL2L10      ------LRSAAARLRQLHRSFFSAYRG----YPGNRVEL-VALMA-EAVL
A0A096MPU7_BCL2-01      PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGR-FATVV-EELF
A0A096NV05_BCL2L1-      --VKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQS-FEQVV-NELF
                                                                   :     :

A0A096NV05_BCL2L1-      RD--G-VNWGRIVAFFSFGGALC------------------VESVDKEMQ
A0A096NMX5_BCL2A1-      ED--GIINWGRIVTIFAFEGILI------------------KKLLRQRIA
A0A096NMX5_BCL2A1-      ED--GIINWGRIVTIFAFEGILI------------------KKLLRQRIA
A0A096NX09_BCL2L2-      QG--G-PNWGRLVAFFVFGAALC------------------AESVNKEME
A0A2I3LFM0_MCL1-03      SD--GVTNWGRIVTLISFGAFVA------------------KHLKTINQE
A0A096NX09_BCL2L2-      QG--G-PNWGRLVAFFVFGAALC------------------AESVNKEME
A0A2I3LFM0_MCL1-01      DGYEP-EPLGKRPAVLPLLELVGESGNSPSTDGSLPSTPPPAEEEEDELY
A0A096NM44_BCL2L10      SDSPG-PTWGRVVSLVTFAGTLLEREPLVTAWWKKRSFQPRLKEQEGDVA
A0A096MPU7_BCL2-01      RD--G-VNWGRIVAFFEFGGVMC------------------VESVNREMS
A0A096NV05_BCL2L1-      RD--G-VNWGRIVAFFSFGGALC------------------VESVDKEMQ
                         .       *.  :.. :   :                            

A0A096NV05_BCL2L1-      VLVSRIAA---WMATYLNDHLEPWIQENGGWD---------------T-F
A0A096NMX5_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWG---------------K--
A0A096NMX5_BCL2A1-      PDVDTYKEISYFVAEFIMNNTGEWIRQNGGWE---------------NGF
A0A096NX09_BCL2L2-      PLVGQVQE---WMVAYLETRLADWIHSSGGWA---------------E-F
A0A2I3LFM0_MCL1-03      SCIEPLAE---SITDVLVRTKRDWLVKQRGWD---------------G-F
A0A096NX09_BCL2L2-      PLVGQVQE---WMVAYLETRLADWIHSSGGWELEAIKARVREMEEEAE-K
A0A2I3LFM0_MCL1-01      RQSLEIIS---W-----------YLREQATGA---------------K-D
A0A096NM44_BCL2L10      RDCQRLVA---LLSSRLAGQHRAWLQAQGGWV---------------S-T
A0A096MPU7_BCL2-01      PLVDNIAL---WMTEYLNRHLHTWIQDNGGWD---------------A-F
A0A096NV05_BCL2L1-      VLVSRIAA---WMATYLNDHLEPWIQENGGWD---------------T-F
                                               ::  .                      

A0A096NV05_BCL2L1-      VELYGNNAAAESRKGQERFN------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      VKKFEP----------K--S------------------------------
A0A096NX09_BCL2L2-      TALYGDGALEEARRLRE--G------------------------------
A0A2I3LFM0_MCL1-03      VEFFHVEDL-------E--G------------------------------
A0A096NX09_BCL2L2-      LKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATA
A0A2I3LFM0_MCL1-01      TKPMGRSGATSRKALETLRRVGDGVQ------------------------
A0A096NM44_BCL2L10      RRTPGRGAGRASGK-RPRGRHGWLLS------------------------
A0A096MPU7_BCL2-01      VELYGPSM-------RPLFDFSWL--------------------------
A0A096NV05_BCL2L1-      VELYGNNAAAESRKGQERFN------------------------------
                                                                          

A0A096NV05_BCL2L1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A2I3LFM0_MCL1-03      --------------------------------------------------
A0A096NX09_BCL2L2-      EELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDES
A0A2I3LFM0_MCL1-01      ---------------------------------------------RNHET
A0A096NM44_BCL2L10      ---------------------------------------------LLQEP
A0A096MPU7_BCL2-01      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
                                                                          

A0A096NV05_BCL2L1-      -----------------------RWFLTGMTVAGVVLLGSLFSRK-----
A0A096NMX5_BCL2A1-      ------------------------WHNHMPM---LVESVAHKKKKMAL--
A0A096NMX5_BCL2A1-      -----------------------GWMTFLEVTGKICEMLSLLKQYC----
A0A096NX09_BCL2L2-      -----------------------NWASVRTVLTGAVALGALVTVGAFFAS
A0A2I3LFM0_MCL1-03      -----------------------GIRNVLLAFAGVAGVGA----GLAYLI
A0A096NX09_BCL2L2-      LFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFN
A0A2I3LFM0_MCL1-01      AFQGWVCGVLPCRGPRRWHQKCAAGFCRCCWSRSWFGISNKIALL-----
A0A096NM44_BCL2L10      LSAGFLEKTADPGFPGMLVSNSLRLSLDTIIMSFNIFNPLLPAQL-----
A0A096MPU7_BCL2-01      ---------------------SLKTLLSLALVGACITLGAYLGHK-----
A0A096NV05_BCL2L1-      -----------------------RWFLTGMTVAGVVLLGSLFSRK-----
                                                                          

A0A096NV05_BCL2L1-      ---------------------
A0A096NMX5_BCL2A1-      ---------------------
A0A096NMX5_BCL2A1-      ---------------------
A0A096NX09_BCL2L2-      K--------------------
A0A2I3LFM0_MCL1-03      R--------------------
A0A096NX09_BCL2L2-      SRPRGRVYRGRARATSWYSPY
A0A2I3LFM0_MCL1-01      ---------------------
A0A096NM44_BCL2L10      ---------------------
A0A096MPU7_BCL2-01      ---------------------
A0A096NV05_BCL2L1-      ---------------------
                                             

© 1998-2020Legal notice