Dataset for protein BCL-2-like of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A096NMX5_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQIPQ-----------------------
A0A096NMX5_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQIPQ-----------------------
A0A2I3LFM0_MCL1-03      ---------MFGLKRNAVIGLNLYCGGAGL--------------------
A0A096NX09_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVC--------------------
A0A096NX09_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVC--------------------
A0A2I3LFM0_MCL1-01      ------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASA
A0A096NM44_BCL2L10      --MADPLRERTERLLADYLGCCAREPG-----------------------
A0A096NV05_BCL2L1-      ----------------------------MW--------------------
A0A096MPU7_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-----------DAGDGAATP
A0A096NV05_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
                                                                          

A0A096NMX5_BCL2A1-      ---------------------------------------------PGLGP
A0A096NMX5_BCL2A1-      ---------------------------------------------PGLGP
A0A2I3LFM0_MCL1-03      ------------------GAGSGGATPPGGRLLATGAKDTKPMGRSGATS
A0A096NX09_BCL2L2-      ------------------GAGPG----------------------EGPAA
A0A096NX09_BCL2L2-      ------------------GAGPG----------------------EGPAA
A0A2I3LFM0_MCL1-01      RREIGGGEAGTVIGGTAGASPPAALTPDARRVARPPPIGAEVPDVTATPA
A0A096NM44_BCL2L10      -----------------------------TPEPRPSTPEAAV--------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A096MPU7_BCL2-01      GAAPAPGIFSSQPGHTPHPAASRDPVARTSPLPTPAAPAAAAGPALSPVP
A0A096NV05_BCL2L1-      METPS-AINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAA--------
                                                                          

A0A096NMX5_BCL2A1-      SKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
A0A096NMX5_BCL2A1-      SKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
A0A2I3LFM0_MCL1-03      RKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-EDDVKSLSRVMVHVFS
A0A096NX09_BCL2L2-      DPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSDELFQ
A0A096NX09_BCL2L2-      DPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSDELFQ
A0A2I3LFM0_MCL1-01      RPLFFAPTRRAAPLEEMEAPAADAIMS-----P-EEELDGYE--------
A0A096NM44_BCL2L10      ------LRSAAARLRQLHRSFFSAYRGY----P-GNRVELVALMAEAVLS
A0A096NV05_BCL2L1-      --KRTGLRPQ-KGLNRRWRPPVPSMATH----P-GTAYQSFEQVVNELFR
A0A096MPU7_BCL2-01      PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-FTARGRFATVVEELFR
A0A096NV05_BCL2L1-      --VKQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFR
                                     .                                    

A0A096NMX5_BCL2A1-      D--GIINWGRIVTIFAFEGILI------------------KKLLRQRIAP
A0A096NMX5_BCL2A1-      D--GIINWGRIVTIFAFEGILI------------------KKLLRQRIAP
A0A2I3LFM0_MCL1-03      D--GVTNWGRIVTLISFGAFVA------------------KHLKTINQES
A0A096NX09_BCL2L2-      G--G-PNWGRLVAFFVFGAALC------------------AESVNKEMEP
A0A096NX09_BCL2L2-      G--G-PNWGRLVAFFVFGAALC------------------AESVNKEMEP
A0A2I3LFM0_MCL1-01      ---P-EPLGKRPAVLPLLELVGESGNSPSTDGSLPSTPPPAEEEEDELYR
A0A096NM44_BCL2L10      DSPG-PTWGRVVSLVTFAGTLLEREPLVTAWWKKRSFQPRLKEQEGDVAR
A0A096NV05_BCL2L1-      D--G-VNWGRIVAFFSFGGALC------------------VESVDKEMQV
A0A096MPU7_BCL2-01      D--G-VNWGRIVAFFEFGGVMC------------------VESVNREMSP
A0A096NV05_BCL2L1-      D--G-VNWGRIVAFFSFGGALC------------------VESVDKEMQV
                                *.  :.. :   :                             

A0A096NMX5_BCL2A1-      DVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEP----------
A0A096NMX5_BCL2A1-      DVDTYKEISYFVAEFIMNNTGEWIRQNGGWGK------------------
A0A2I3LFM0_MCL1-03      CIEPLAE---SITDVLVRTKRDWLVKQRGWD-GFVEFFHVEDLE------
A0A096NX09_BCL2L2-      LVGQVQE---WMVAYLETRLADWIHSSGGWA-EFTALYGDGALEEARRLR
A0A096NX09_BCL2L2-      LVGQVQE---WMVAYLETRLADWIHSSGGWELEAIKARVREMEEEAEKLK
A0A2I3LFM0_MCL1-01      QSLEIIS---W-----------YLREQATGA-KDTKPMGRSGATSRKALE
A0A096NM44_BCL2L10      DCQRLVA---LLSSRLAGQHRAWLQAQGGWV-STRRTPGRGAGRA-----
A0A096NV05_BCL2L1-      LVSRIAA---WMATYLNDHLEPWIQENGGWD-TFVELYGNNAAAE-----
A0A096MPU7_BCL2-01      LVDNIAL---WMTEYLNRHLHTWIQDNGGWD-AFVELYGPSM--------
A0A096NV05_BCL2L1-      LVSRIAA---WMATYLNDHLEPWIQENGGWD-TFVELYGNNAAAE-----
                                              ::  .                       

A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2I3LFM0_MCL1-03      ----------------GG---------------------------IRNV-
A0A096NX09_BCL2L2-      E---------------GN---------------------------WASV-
A0A096NX09_BCL2L2-      ELQNEVEKQMNMSPPPGN---------------------------AGPVI
A0A2I3LFM0_MCL1-01      TLRRVGDGVQRNHETAFQ------GWVCGVLPCRGPRRWHQKCAA-----
A0A096NM44_BCL2L10      ---------SGKRPRGRH------GWLLSLLQEPLSAGFLEKTADPGFPG
A0A096NV05_BCL2L1-      ---------SRKGQERFN------RWFLTGM-------------------
A0A096MPU7_BCL2-01      -------------RPLFDFSWLSLKTLLSLA-------------------
A0A096NV05_BCL2L1-      ---------SRKGQERFN------RWFLTGM-------------------
                                                                          

A0A096NMX5_BCL2A1-      -----------KSGWMTFLEVTGKICEMLSLLKQYC--------------
A0A096NMX5_BCL2A1-      --------------WHNHMPM---LVESVAHKKKKMAL------------
A0A2I3LFM0_MCL1-03      -----------LLAFAGVAGVGAGLA------------------------
A0A096NX09_BCL2L2-      -----------RTVLTGAVALGALVT------------------------
A0A096NX09_BCL2L2-      MSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSG
A0A2I3LFM0_MCL1-01      -------------GFCRCCWSRSWFGISNKIALL----------------
A0A096NM44_BCL2L10      MLVSNSLRLSLDTIIMSFNIFNPLLPAQL---------------------
A0A096NV05_BCL2L1-      -------------TVAGVVLLGSLFSRK----------------------
A0A096MPU7_BCL2-01      -------------LVGACITLGAYLGHK----------------------
A0A096NV05_BCL2L1-      -------------TVAGVVLLGSLFSRK----------------------
                                                                          

A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2I3LFM0_MCL1-03      --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A096NX09_BCL2L2-      HPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRG
A0A2I3LFM0_MCL1-01      --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
A0A096MPU7_BCL2-01      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
                                                                          

A0A096NMX5_BCL2A1-      ----------------------------------------------
A0A096NMX5_BCL2A1-      ----------------------------------------------
A0A2I3LFM0_MCL1-03      ------------------------------------------YLIR
A0A096NX09_BCL2L2-      --------------------------------------VGAFFASK
A0A096NX09_BCL2L2-      FPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2I3LFM0_MCL1-01      ----------------------------------------------
A0A096NM44_BCL2L10      ----------------------------------------------
A0A096NV05_BCL2L1-      ----------------------------------------------
A0A096MPU7_BCL2-01      ----------------------------------------------
A0A096NV05_BCL2L1-      ----------------------------------------------
                                                                      

© 1998-2020Legal notice