Dataset for protein BCL-2-like of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A096MRS6_MCL1-02      ---------------------MFGLKRNAVIGLNLYCG-----------G
A0A096MRS6_MCL1-01      ---------------------MFGLKRNAVIGLNLYCG-----------G
A0A096MRS6_MCL1-04      ---------------------MFGLKRNAVIGLNLYCG-----------G
A0A096MPU7_BCL2-01      --------MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-----------D
A0A8I5MVB8_BCL2L1-      --------------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTE
A0A8I5NQD2_BCL2L10      TVESLRGRTMADPLRERTER-LLADYLG--------CC-----------A
A0A096MRS6_MCL1-03      ---------------------MFGLKRNAVIGLNLYCG-----------G
A0A096NM44_BCL2L10      ---------MADPLRERTER-LLADYLG--------CC-----------A
A0A2I3MUE4_BCL2L2-      ---------MATPASAPDTRALVADFVGYKLRQKGYVC-----------G
                                             :.                           

A0A096MRS6_MCL1-02      AGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAA
A0A096MRS6_MCL1-01      AGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAA
A0A096MRS6_MCL1-04      AGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAA
A0A096MPU7_BCL2-01      AGDGAATPGAAPAPGIFS--------------------------------
A0A8I5MVB8_BCL2L1-      APEGTESEMETPS-AING--------------------------------
A0A8I5NQD2_BCL2L10      REPGTPEPRPSTP-------------------------------------
A0A096MRS6_MCL1-03      AGLGAGSGGATPPGGRLL--------------------------------
A0A096NM44_BCL2L10      REPGTPEPRPSTP-------------------------------------
A0A2I3MUE4_BCL2L2-      AGPG--EGPAADP-------------------------------------
                           *      : .                                     

A0A096MRS6_MCL1-02      LTPDARRVARPPPIGAEVPDVTATPARPLFFAPTRRAAPLEEMEAPAADA
A0A096MRS6_MCL1-01      LTPDARRVARPPPIGAEVPDVTATPARPLFFAPTRRAAPLEEMEAPAADA
A0A096MRS6_MCL1-04      LTPDARRVARPPPIGAEVPDVTATPARPLFFAPTRRAAPLEEMEAPAADA
A0A096MPU7_BCL2-01      --------------------------------------------------
A0A8I5MVB8_BCL2L1-      --------------------------------------------------
A0A8I5NQD2_BCL2L10      --------------------------------------------------
A0A096MRS6_MCL1-03      --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2I3MUE4_BCL2L2-      --------------------------------------------------
                                                                          

A0A096MRS6_MCL1-02      IMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSLPSTPPPAE
A0A096MRS6_MCL1-01      IMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSLPSTPPPAE
A0A096MRS6_MCL1-04      IMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSLPSTPPPAE
A0A096MPU7_BCL2-01      --------------------------------------------------
A0A8I5MVB8_BCL2L1-      --------------------------------------------------
A0A8I5NQD2_BCL2L10      --------------------------------------------------
A0A096MRS6_MCL1-03      --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2I3MUE4_BCL2L2-      --------------------------------------------------
                                                                          

A0A096MRS6_MCL1-02      EEEDELYRQSLEIISWYLREQATGAKDTKPMGRSGATSRK----------
A0A096MRS6_MCL1-01      EEEDELYRQSLEIISWYLREQATGAKDTKPMGRSGATSRK----------
A0A096MRS6_MCL1-04      EEEDELYRQSLEIISWYLREQATGAKDTKPMGRSGATSRK----------
A0A096MPU7_BCL2-01      ---------------------SQPGHTPHPAASRDPVARTSPLPTPAAPA
A0A8I5MVB8_BCL2L1-      ---------------------NPSWHLVDSPAVNGATGHSSSLDAREVIP
A0A8I5NQD2_BCL2L10      --------------------------------------------------
A0A096MRS6_MCL1-03      ---------------------ATGAKDTKPMGRSGATSRK----------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A2I3MUE4_BCL2L2-      --------------------------------------------------
                                                                          

A0A096MRS6_MCL1-02      -------------ALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS
A0A096MRS6_MCL1-01      -------------ALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS
A0A096MRS6_MCL1-04      -------------ALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS
A0A096MPU7_BCL2-01      AAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGR
A0A8I5MVB8_BCL2L1-      MAA----------VKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQS
A0A8I5NQD2_BCL2L10      -------------EAAVLRSAA----ARLRQLHRSFFSAYRGYPGNRVEL
A0A096MRS6_MCL1-03      -------------ALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS
A0A096NM44_BCL2L10      -------------EAAVLRSAA----ARLRQLHRSFFSAYRGYPGNRVEL
A0A2I3MUE4_BCL2L2-      -------------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQR
                                        .:* ..     .    .  :              

A0A096MRS6_MCL1-02      LSRVMVHVFSDG-VTNWGRIVTLISFGAFV--------------AKHLKT
A0A096MRS6_MCL1-01      LSRVMVHVFSDG-VTNWGRIVTLISFGAFV--------------AKHLKT
A0A096MRS6_MCL1-04      LSRVMVHVFSDG-VTNWGRIVTLISFGAFV--------------AKHLKT
A0A096MPU7_BCL2-01      FATVVEELFRD--GVNWGRIVAFFEFGGVM--------------CVESVN
A0A8I5MVB8_BCL2L1-      FEQVVNELFRD--GVNWGRIVAFFSFGGAL--------------CVESVD
A0A8I5NQD2_BCL2L10      VALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREPLVTAWWKKRSFQPRL
A0A096MRS6_MCL1-03      LSRVMVHVFSDG-VTNWGRIVTLISFGAFV--------------AKHLKT
A0A096NM44_BCL2L10      VALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREPLVTAWWKKRSFQPRL
A0A2I3MUE4_BCL2L2-      FTQVSDELFQG--GPNWGRLVAFFVFGAAL--------------CAESVN
                        .  :   :: .    .***:*::. *.. :              .     

A0A096MRS6_MCL1-02      INQESCIEPLAESITDVLVRTKRD----WLVKQRGWDGFVEFFHVEDLEG
A0A096MRS6_MCL1-01      INQESCIEPLAESITDVLVRTKRD----WLVKQRGWGKTCSPLV------
A0A096MRS6_MCL1-04      INQESCIEPLAESITDVLVRTKRD----WLVKQRGWAIFCSSSVEYSSVD
A0A096MPU7_BCL2-01      REMSPLVDNIALWMTEYLNRHLHT----WIQDNGGWDAFVELYGPSM---
A0A8I5MVB8_BCL2L1-      KEMQVLVSRIAAWMATYLNDHLEP----WIQENGGWDTFVELYGNNAAAE
A0A8I5NQD2_BCL2L10      KEQEGDVARDCQRLVALLSSRLAGQHRAWLQAQGGWDGFCHFFRS-----
A0A096MRS6_MCL1-03      INQESCIEPLAESITDVLVRTKRD----WLVKQRGWDGFVEFFHVEDLEG
A0A096NM44_BCL2L10      KEQEGDVARDCQRLVALLSSRLAGQHRAWLQAQGGWDGFCHFFRS-----
A0A2I3MUE4_BCL2L2-      KEMEPLVGQVQEWMVAYLETRLAD----WIHSSGGWAEFTALYGDGALEE
                         : .  :      :.  *          *:  . **              

A0A096MRS6_MCL1-02      GI------------RNVLLAFAGVAGVGAGLAYLIR---
A0A096MRS6_MCL1-01      ----------------------FMCILWG----------
A0A096MRS6_MCL1-04      SN------------HEEISHQGRIAEIHS----------
A0A096MPU7_BCL2-01      ----RPLFDFSWLSLKTLLSLALVGACITLGAYLGHK--
A0A8I5MVB8_BCL2L1-      SRKGQERFN------RWFLTGMTVAGVVLLGSLFSRK--
A0A8I5NQD2_BCL2L10      ----PFPLAFW---RKLLIQAFLACLLATAFGYLWTRLL
A0A096MRS6_MCL1-03      GI------------RNVLLAFAGVAGVGAGLAYLIR---
A0A096NM44_BCL2L10      ----PFPLAFW---RKLLIQAFLACLLATAFGYLWTRLL
A0A2I3MUE4_BCL2L2-      AR--RLREGNWASVRTVLTGAVALGALVTVGAFFASK--
                                                               

© 1998-2023Legal notice