Dataset for protein BCL-2-like of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A096NV05_BCL2L1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQIPQ-----------------------
A0A096NMX5_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQIPQ-----------------------
A0A096MRS6_MCL1-03      -------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLA
A0A096NX09_BCL2L2-      -----MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG-----------
A0A096MRS6_MCL1-01      -------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLA
A0A096MRS6_MCL1-02      -------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLA
A0A096NX09_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMR
A0A096NX09_BCL2L2-      -MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNG
A0A096NX09_BCL2L2-      -MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNG
A0A096NM44_BCL2L10      --MADPLRERTERLLADYLGCCAREPG-----------------------
A0A096MPU7_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-----------DAGDGAATP
A0A096NV05_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
                                                                          

A0A096NV05_BCL2L1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096MRS6_MCL1-03      TGAKDTKPMG----------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A096MRS6_MCL1-01      TEKEASARRE-----------------IGGGEAGTVIGGTAGASPPAALT
A0A096MRS6_MCL1-02      TEKEASARRE-----------------IGGGEAGTVIGGTAGASPPAALT
A0A096NX09_BCL2L2-      AAGDEFETRF----------------RRTFSDLAAQLHVTPGSAQQRFTQ
A0A096NX09_BCL2L2-      LESEELEPEELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEE
A0A096NX09_BCL2L2-      LESEELEPED------------------------------------QEEE
A0A096NM44_BCL2L10      -------------------------------------------------T
A0A096MPU7_BCL2-01      GAAPAPGIFS--------------------SQPGHTPHPAASRDPVARTS
A0A096NV05_BCL2L1-      METPS-AING--------------------NPSWHLVDSPAVNGATGHSS
                                                                          

A0A096NV05_BCL2L1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096MRS6_MCL1-03      --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A096MRS6_MCL1-01      PDARRVARPPPIGAE-----------------------------------
A0A096MRS6_MCL1-02      PDARRVARPPPIGAE-----------------------------------
A0A096NX09_BCL2L2-      VSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLE
A0A096NX09_BCL2L2-      EEPGLVEGDPGDGAI-----------------------------------
A0A096NX09_BCL2L2-      EEPGLVEGDPGDGAI-----------------------------------
A0A096NM44_BCL2L10      PEPRPSTPEAAV--------------------------------------
A0A096MPU7_BCL2-01      PLPTPAAPAAAAGPA-----------------------------------
A0A096NV05_BCL2L1-      SLDAREVIPMAA--------------------------------------
                                                                          

A0A096NV05_BCL2L1-      --------------------MWKRTGLRPQKGLNRRWRPPVPSMATH--P
A0A096NMX5_BCL2A1-      ----------PGLGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVAS-I
A0A096NMX5_BCL2A1-      ----------PGLGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVAS-I
A0A096MRS6_MCL1-03      ---------RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIK--N
A0A096NX09_BCL2L2-      ----------EGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVT--P
A0A096MRS6_MCL1-01      --VPDVTATPARPLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEP
A0A096MRS6_MCL1-02      --VPDVTATPARPLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEP
A0A096NX09_BCL2L2-      TRLADWIHSSGGWELEAIKARVREMEE-EAEKLKELQNEVEKQMNMSPPP
A0A096NX09_BCL2L2-      ----------EDPELEAIKARVREMEE-EAEKLKELQNEVEKQMNMSPPP
A0A096NX09_BCL2L2-      ----------EDPELEAIKARVREMEE-EAEKLKELQNEVEKQMNMSPPP
A0A096NM44_BCL2L10      ---------------------LRSAAARLRQLHRSFFSAYRG----Y--P
A0A096MPU7_BCL2-01      ----------LSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLT--P
A0A096NV05_BCL2L1-      -----------------VKQALREAGDEFELRYRRAFSDLTSQLHIT--P
                                                                          

A0A096NV05_BCL2L1-      GTAYQSFEQVVNELFRD--GVNWGRI---------VAFFSFGGALC----
A0A096NMX5_BCL2A1-      DTARTLFNQVMEKEFEDG-IINWGRI---------VTIFAFEGILIKKL-
A0A096NMX5_BCL2A1-      DTARTLFNQVMEKEFEDG-IINWGRI---------VTIFAFEGILIKKL-
A0A096MRS6_MCL1-03      EDDVKSLSRVMVHVFSDGVT-NWGRI---------VTLISFGAFVA----
A0A096NX09_BCL2L2-      GSAQQRFTQVSDELFQGG-P-NWGRL---------VAFFVFGAALC----
A0A096MRS6_MCL1-01      LGKRPAVLPLLE---------LVGESGNSPSTD-----------------
A0A096MRS6_MCL1-02      LGKRPAVLPLLE---------LVGESGNSPSTD-----------------
A0A096NX09_BCL2L2-      GNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTI
A0A096NX09_BCL2L2-      GNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTI
A0A096NX09_BCL2L2-      GNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTI
A0A096NM44_BCL2L10      GNRVELVALMAEAVLSDSPGPTWGRV---------VSLVTFAGTLLEREP
A0A096MPU7_BCL2-01      FTARGRFATVVEELFRD--GVNWGRI---------VAFFEFGGVMC----
A0A096NV05_BCL2L1-      GTAYQSFEQVVNELFRD--GVNWGRI---------VAFFSFGGALC----
                              .  :             *                          

A0A096NV05_BCL2L1-      --------------VESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGG
A0A096NMX5_BCL2A1-      --------------LRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGG
A0A096NMX5_BCL2A1-      --------------LRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGG
A0A096MRS6_MCL1-03      --------------KHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRG
A0A096NX09_BCL2L2-      --------------AESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGG
A0A096MRS6_MCL1-01      -----GSLPSTPPPAEEEEDELYRQSLEIISWYLREQATGAKDTKPMGRS
A0A096MRS6_MCL1-02      -----GSLPSTPPPAEEEEDELYRQSLEIISWYLREQATGAKDTKPMGRS
A0A096NX09_BCL2L2-      LCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPG
A0A096NX09_BCL2L2-      LCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPG
A0A096NX09_BCL2L2-      LCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPG
A0A096NM44_BCL2L10      LVTAWWKKRSFQPRLKEQEGDVARDCQRLVALLSSRLAGQHRAWLQAQGG
A0A096MPU7_BCL2-01      --------------VESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGG
A0A096NV05_BCL2L1-      --------------VESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGG
                                                    :                    .

A0A096NV05_BCL2L1-      WDT-----------FVELYGNNAAAESRKGQERFN---------------
A0A096NMX5_BCL2A1-      WGK-----------WHNHMPM---LVESVAHKKKKMAL------------
A0A096NMX5_BCL2A1-      WENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC--------------
A0A096MRS6_MCL1-03      WDG-----------FVEFFHVEDL-------EGG----------------
A0A096NX09_BCL2L2-      WAE-----------FTALYGDGALEEARRLREGN----------------
A0A096MRS6_MCL1-01      GAT-----------SRKALETLRRVGDGVQRNHETA--FQGWVCGV----
A0A096MRS6_MCL1-02      GAT-----------SRKALETLRRVGDGVQRNHETA--FQGMLRKLDIKN
A0A096NX09_BCL2L2-      IST-----------TDRGFPRARYRARTTNYNSSRSRFYSGFNSRP----
A0A096NX09_BCL2L2-      IST-----------TDRGFPRARYRARTTNYNSSRSRFYSGFNSRP----
A0A096NX09_BCL2L2-      IST-----------TDRGFPRARYRARTTNYNSSRSRFYSGFNSRP----
A0A096NM44_BCL2L10      WVS-----------TRRTPGRGAGRASGK-RPRGRHGWLLSLLQEP----
A0A096MPU7_BCL2-01      WDA-----------FVELYGPSM-------RPLFDFSWL-----------
A0A096NV05_BCL2L1-      WDT-----------FVELYGNNAAAESRKGQERFN---------------
                                                                          

A0A096NV05_BCL2L1-      ------------------------------------------------RW
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096MRS6_MCL1-03      -------------------------------------------IRNVLLA
A0A096NX09_BCL2L2-      -------------------------------------------WASVRTV
A0A096MRS6_MCL1-01      -------------LPCRGPRRW---------------------HQKCAAG
A0A096MRS6_MCL1-02      EDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
A0A096NX09_BCL2L2-      -------------------------------------------RGRVYRG
A0A096NX09_BCL2L2-      -------------------------------------------RGRVYRG
A0A096NX09_BCL2L2-      -------------------------------------------RGRVYRG
A0A096NM44_BCL2L10      -------------------------LSAGFLEKTADPGFPGMLVSNSLRL
A0A096MPU7_BCL2-01      ----------------------------------------------SLKT
A0A096NV05_BCL2L1-      ------------------------------------------------RW
                                                                          

A0A096NV05_BCL2L1-      FLTGMTVAGVVLLGSLFSRK------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096MRS6_MCL1-03      FAGVAGVGA----GLAYLIR------------------------------
A0A096NX09_BCL2L2-      LTGAVALGALVTVGAFFASK------------------------------
A0A096MRS6_MCL1-01      FCRCCWS------RSWF---------------------------------
A0A096MRS6_MCL1-02      LAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVA
A0A096NX09_BCL2L2-      RARA---------TSWYSPY------------------------------
A0A096NX09_BCL2L2-      RARA---------TSWYSPY------------------------------
A0A096NX09_BCL2L2-      RARA---------TSWYSPY------------------------------
A0A096NM44_BCL2L10      SLDTIIMSFNIFNPLLPAQL------------------------------
A0A096MPU7_BCL2-01      LLSLALVGACITLGAYLGHK------------------------------
A0A096NV05_BCL2L1-      FLTGMTVAGVVLLGSLFSRK------------------------------
                                                                          

A0A096NV05_BCL2L1-      -----------
A0A096NMX5_BCL2A1-      -----------
A0A096NMX5_BCL2A1-      -----------
A0A096MRS6_MCL1-03      -----------
A0A096NX09_BCL2L2-      -----------
A0A096MRS6_MCL1-01      GISNKIALL--
A0A096MRS6_MCL1-02      GVGAGLAYLIR
A0A096NX09_BCL2L2-      -----------
A0A096NX09_BCL2L2-      -----------
A0A096NX09_BCL2L2-      -----------
A0A096NM44_BCL2L10      -----------
A0A096MPU7_BCL2-01      -----------
A0A096NV05_BCL2L1-      -----------
                                   

© 1998-2021Legal notice