Dataset for protein BCL-2-like of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A096NV05_BCL2L1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQIPQP----------------------
A0A096NMX5_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQIPQP----------------------
A0A096MRS6_MCL1-03      ---------MFGLKRNAVIGLNLYCGGA----------------------
A0A096NX09_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGY----------------------
A0A096NX09_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYV---------------------
A0A096NX09_BCL2L2-      -----MAAAAAAAAAAGAAGGR----------------------------
A0A096NX09_BCL2L2-      -----MAAAAAAAAAAGAAGGR----------------------------
A0A096MRS6_MCL1-01      ---MFGLKRNAVIGLNLYCGGA----------------------------
A0A096MRS6_MCL1-02      ---MFGLKRNAVIGLNLYCGGA----------------------------
A0A096NM44_BCL2L10      --MADPLRERTERLLADYLGCCAREPG-----------------------
A0A096MPU7_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-----------DAGDGAATP
A0A096NV05_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
                                                                          

A0A096NV05_BCL2L1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      ------------------------------GLGPSKTSRV----------
A0A096NMX5_BCL2A1-      ------------------------------GLGPSKTSRV----------
A0A096MRS6_MCL1-03      ------------------------------GLGAGSGGATPPGGRLLATG
A0A096NX09_BCL2L2-      ------------------------------VCGAGPG-------------
A0A096NX09_BCL2L2-      -----------------------------CGAGPGEGPAADPLHQ-----
A0A096NX09_BCL2L2-      ------------------------------GSGPGRRRHLVPG-------
A0A096NX09_BCL2L2-      ------------------------------GSGPGRRRHLVPG-------
A0A096MRS6_MCL1-01      ------------------------------GLGAGSGGATPPGGR-----
A0A096MRS6_MCL1-02      ------------------------------GLGAGSGGATPPGGR-----
A0A096NM44_BCL2L10      -----------------------------TPEPRPSTPEAAV--------
A0A096MPU7_BCL2-01      GAAPAPGIFSSQPGHTPHPAASRDPVARTSPLPTPAAPAAAAGPA-----
A0A096NV05_BCL2L1-      METPS-AINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAA--------
                                                                          

A0A096NV05_BCL2L1-      -------------------MWKRTGLRPQKGLNRRWRPPVPSMATHPGTA
A0A096NMX5_BCL2A1-      --------------------LQKVAFSVQKEVEKNLKPCLDNVNVASIDT
A0A096NMX5_BCL2A1-      --------------------LQKVAFSVQKEVEKNLKPCLDNVNVASIDT
A0A096MRS6_MCL1-03      AKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDD
A0A096NX09_BCL2L2-      ---------EGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSA
A0A096NX09_BCL2L2-      ---------AMRA----------AGDEFETRFRRTFSDLAAQLHVTPGSA
A0A096NX09_BCL2L2-      -----------------------AGGEAGEGAPGGAGDYGNGLESEELEP
A0A096NX09_BCL2L2-      -----------------------AGGEAGEGAPGGAGDYGNGLESEELEP
A0A096MRS6_MCL1-01      ---------LLATEKEASARREIGGGEAGTVIGGTAG----ASPPAALTP
A0A096MRS6_MCL1-02      ---------LLATEKEASARREIGGGEAGTVIGGTAG----ASPPAALTP
A0A096NM44_BCL2L10      --------------------LRSAAARLRQLHRSFFSAYRG----YPGNR
A0A096MPU7_BCL2-01      ---------LSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTA
A0A096NV05_BCL2L1-      ----------------VKQALREAGDEFELRYRRAFSDLTSQLHITPGTA
                                                .                         

A0A096NV05_BCL2L1-      YQ--SFEQVVNELFRD--G-VNWGRIVAFFSFGGALC-------------
A0A096NMX5_BCL2A1-      AR-TLFNQVMEKEFED--GIINWGRIVTIFAFEGILI-------------
A0A096NMX5_BCL2A1-      AR-TLFNQVMEKEFED--GIINWGRIVTIFAFEGILI-------------
A0A096MRS6_MCL1-03      VK--SLSRVMVHVFSD--GVTNWGRIVTLISFGAFVA-------------
A0A096NX09_BCL2L2-      QQ--RFTQVSDELFQG--G-PNWGRLVAFFVFGAALC-------------
A0A096NX09_BCL2L2-      QQ--RFTQVSDELFQG--G-PNWGRLVAFFVFGAALC-------------
A0A096NX09_BCL2L2-      EELLLEPEPEPEPEEE--P-PRPRAPPGAPGPGPGSG-------------
A0A096NX09_BCL2L2-      ED------------------------------------------------
A0A096MRS6_MCL1-01      DA--RRVARPPPIGAE--V-PDVTATPARPLFFAPTR-------------
A0A096MRS6_MCL1-02      DA--RRVARPPPIGAE--V-PDVTATPARPLFFAPTR-------------
A0A096NM44_BCL2L10      VE--LVALMAEAVLSDSPG-PTWGRVVSLVTFAGTLLEREPLVTAWWKKR
A0A096MPU7_BCL2-01      RG--RFATVVEELFRD--G-VNWGRIVAFFEFGGVMC-------------
A0A096NV05_BCL2L1-      YQ--SFEQVVNELFRD--G-VNWGRIVAFFSFGGALC-------------
                                                                          

A0A096NV05_BCL2L1-      -----VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGWD----
A0A096NMX5_BCL2A1-      -----KKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGK---
A0A096NMX5_BCL2A1-      -----KKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFV
A0A096MRS6_MCL1-03      -----KHLKTINQESCIE---PLAESITDVLVRTKRDWLVKQRGWD----
A0A096NX09_BCL2L2-      -----AESVNKEMEPLVG---QVQEWMVAYLETRLADWIHSSGGWA----
A0A096NX09_BCL2L2-      -----AESVNKEMEPLVG---QVQEWMVAYLETRLADWIHSSGGWELEAI
A0A096NX09_BCL2L2-      -----APGSQEEEEEPGL---VEGDPGDGAIE-----------DPELEAI
A0A096NX09_BCL2L2-      ---------QEEEEEPGL---VEGDPGDGAIE-----------DPELEAI
A0A096MRS6_MCL1-01      -----RAAPLEEMEAPAA---DAIMSPEEELD-----------GYEPEPL
A0A096MRS6_MCL1-02      -----RAAPLEEMEAPAA---DAIMSPEEELD-----------GYEPEPL
A0A096NM44_BCL2L10      SFQPRLKEQEGDVARDCQ---RLVALLSSRLAGQHRAWLQAQGGWV----
A0A096MPU7_BCL2-01      -----VESVNREMSPLVD---NIALWMTEYLNRHLHTWIQDNGGWD----
A0A096NV05_BCL2L1-      -----VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGWD----
                                                      :            .      

A0A096NV05_BCL2L1-      ------------TFVELYGN------------------------------
A0A096NMX5_BCL2A1-      --------WH--NHMPM---LVESVAHKKKKMAL----------------
A0A096NMX5_BCL2A1-      KKFEPKSGWM--TFLEVTGKICEMLSLLKQYC------------------
A0A096MRS6_MCL1-03      ------------GFVEFFHV------------------------------
A0A096NX09_BCL2L2-      ------------EFTALYGD------------------------------
A0A096NX09_BCL2L2-      KARVREMEEEAEKLKELQNE------VEKQMNMSPPPGNAGPVIMSIEEK
A0A096NX09_BCL2L2-      KARVREMEEEAEKLKELQNE------VEKQMNMSPPPGNAGPVIMSIEEK
A0A096NX09_BCL2L2-      KARVREMEEEAEKLKELQNE------VEKQMNMSPPPGNAGPVIMSIEEK
A0A096MRS6_MCL1-01      GKRPAVL-----PLLELVGESGNSPSTDGSLPSTPPPAEEE------EDE
A0A096MRS6_MCL1-02      GKRPAVL-----PLLELVGESGNSPSTDGSLPSTPPPAEEE------EDE
A0A096NM44_BCL2L10      ------------STRRTPGR-----GAGRASGK-RPRGRHGWLLSLLQEP
A0A096MPU7_BCL2-01      ------------AFVELYGP-----SM-------RPLFDFSWL-------
A0A096NV05_BCL2L1-      ------------TFVELYGN-----NAAAESRKGQERFN-----------
                                                                          

A0A096NV05_BCL2L1-      ---------NAAAESRKGQERFNRWFLTGMTVAGVVLL------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096MRS6_MCL1-03      -----EDL-------EGGIRNVLLAFAGVAGVGA----------------
A0A096NX09_BCL2L2-      -----GALEEARRLREGNWASVRTVLTGAVALGALVTV------------
A0A096NX09_BCL2L2-      MEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFA
A0A096NX09_BCL2L2-      MEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFA
A0A096NX09_BCL2L2-      MEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFA
A0A096MRS6_MCL1-01      LYRQSLEIISWYLREQATGAKDTKPMGRSGATSRKALETLRRVG------
A0A096MRS6_MCL1-02      LYRQSLEIISWYLREQATGAKDTKPMGRSGATSRKALETLRRVG------
A0A096NM44_BCL2L10      LSAGFLEKTADPGFPGMLVSNSLRLSLDTIIMSFNIFN------------
A0A096MPU7_BCL2-01      ---------------------SLKTLLSLALVGACITL------------
A0A096NV05_BCL2L1-      -----------------------RWFLTGMTVAGVVLL------------
                                                                          

A0A096NV05_BCL2L1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096MRS6_MCL1-03      --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A096NX09_BCL2L2-      YIEFSDKESVRTSLALDESLFRGRQIKV------IPKRTNRPGISTTDRG
A0A096NX09_BCL2L2-      YIEFSDKESVRTSLALDESLFRGRQIKV------IPKRTNRPGISTTDRG
A0A096NX09_BCL2L2-      YIEFSDKESVRTSLALDESLFRGRQIKV------IPKRTNRPGISTTDRG
A0A096MRS6_MCL1-01      -------DGVQRN---HETAFQGWVCGV-----------------LPCRG
A0A096MRS6_MCL1-02      -------DGVQRN---HETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDG
A0A096NM44_BCL2L10      --------------------------------------------------
A0A096MPU7_BCL2-01      --------------------------------------------------
A0A096NV05_BCL2L1-      --------------------------------------------------
                                                                          

A0A096NV05_BCL2L1-      ---------------------------------------------GSLFS
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096MRS6_MCL1-03      ---------------------------------------------GLAYL
A0A096NX09_BCL2L2-      ---------------------------------------------GAFFA
A0A096NX09_BCL2L2-      FPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARA------TSWYS
A0A096NX09_BCL2L2-      FPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARA------TSWYS
A0A096NX09_BCL2L2-      FPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARA------TSWYS
A0A096MRS6_MCL1-01      PRRW---------------------HQKCAAGFCRCCWS------RSWF-
A0A096MRS6_MCL1-02      VTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLV
A0A096NM44_BCL2L10      ---------------------------------------------PLLPA
A0A096MPU7_BCL2-01      ---------------------------------------------GAYLG
A0A096NV05_BCL2L1-      ---------------------------------------------GSLFS
                                                                          

A0A096NV05_BCL2L1-      RK-----------------------------------------
A0A096NMX5_BCL2A1-      -------------------------------------------
A0A096NMX5_BCL2A1-      -------------------------------------------
A0A096MRS6_MCL1-03      IR-----------------------------------------
A0A096NX09_BCL2L2-      SK-----------------------------------------
A0A096NX09_BCL2L2-      PY-----------------------------------------
A0A096NX09_BCL2L2-      PY-----------------------------------------
A0A096NX09_BCL2L2-      PY-----------------------------------------
A0A096MRS6_MCL1-01      --------------------------------GISNKIALL--
A0A096MRS6_MCL1-02      KQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A096NM44_BCL2L10      QL-----------------------------------------
A0A096MPU7_BCL2-01      HK-----------------------------------------
A0A096NV05_BCL2L1-      RK-----------------------------------------
                                                                   

© 1998-2021Legal notice