Dataset for protein BCL-2-like of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2I3LFM0_MCL1-02      -------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLA
A0A2I3LFM0_MCL1-01      -------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLA
A0A096NX09_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMR
A0A096NX09_BCL2L2-      -MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNG
A0A096NX09_BCL2L2-      -MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNG
A0A096NM44_BCL2L10      --MADPLRERTERLLADYLGCCAREPG-----------------------
A0A096MPU7_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-----------DAGDGAATP
A0A096NV05_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
A0A096NMX5_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQIPQPGLGPSKT---------------
A0A096NMX5_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQIPQPGLGPSKT---------------
A0A096NX09_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG---------------
A0A2I3LFM0_MCL1-03      ---------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATGAK
                                                                          

A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2I3LFM0_MCL1-02      TEKEASARRE-----------------IGGGEAGTVIGGTAGASPPAALT
A0A2I3LFM0_MCL1-01      TEKEASARRE-----------------IGGGEAGTVIGGTAGASPPAALT
A0A096NX09_BCL2L2-      AAGDEFETRF----------------RRTFSDLAAQLHVTPGSAQQRFTQ
A0A096NX09_BCL2L2-      LESEELEPED------------------------------------QEEE
A0A096NX09_BCL2L2-      LESEELEPEELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEE
A0A096NM44_BCL2L10      -------------------------------------------------T
A0A096MPU7_BCL2-01      GAAPAPG--------------------IFSSQPGHTPHPAASRDPVARTS
A0A096NV05_BCL2L1-      METPS-A--------------------INGNPSWHLVDSPAVNGATGHSS
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A2I3LFM0_MCL1-03      DTKPMGR-------------------------------------------
                                                                          

A0A096NV05_BCL2L1-      --------------------------------------------------
A0A2I3LFM0_MCL1-02      PDARRVARPPPIGAE-----------------------------------
A0A2I3LFM0_MCL1-01      PDARRVARPPPIGAE-----------------------------------
A0A096NX09_BCL2L2-      VSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLE
A0A096NX09_BCL2L2-      EEPGLVEGDPGDGAI-----------------------------------
A0A096NX09_BCL2L2-      EEPGLVEGDPGDGAI-----------------------------------
A0A096NM44_BCL2L10      PEPRPSTPEAAV--------------------------------------
A0A096MPU7_BCL2-01      PLPTPAAPAAAAGPA-----------------------------------
A0A096NV05_BCL2L1-      SLDAREVIPMAA--------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NX09_BCL2L2-      --------------------------------------------------
A0A2I3LFM0_MCL1-03      --------------------------------------------------
                                                                          

A0A096NV05_BCL2L1-      --------------------MWKRTGLRPQKGLNRRWRPPVPSMATH--P
A0A2I3LFM0_MCL1-02      --VPDVTATPARPLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEP
A0A2I3LFM0_MCL1-01      --VPDVTATPARPLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEP
A0A096NX09_BCL2L2-      TRLADWIHSSGGWELEAIKARVREMEE-EAEKLKELQNEVEKQMNMSPPP
A0A096NX09_BCL2L2-      ----------EDPELEAIKARVREMEE-EAEKLKELQNEVEKQMNMSPPP
A0A096NX09_BCL2L2-      ----------EDPELEAIKARVREMEE-EAEKLKELQNEVEKQMNMSPPP
A0A096NM44_BCL2L10      ---------------------LRSAAARLRQLHRSFFSAYRG----Y--P
A0A096MPU7_BCL2-01      ----------LSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLT--P
A0A096NV05_BCL2L1-      -----------------VKQALREAGDEFELRYRRAFSDLTSQLHIT--P
A0A096NMX5_BCL2A1-      ------------------SRVLQKVAFSVQKEVEKNLKPCLDNVNVA--S
A0A096NMX5_BCL2A1-      ------------------SRVLQKVAFSVQKEVEKNLKPCLDNVNVA--S
A0A096NX09_BCL2L2-      ----------EGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVT--P
A0A2I3LFM0_MCL1-03      ----------SGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIK--N
                                                                          

A0A096NV05_BCL2L1-      GTAYQSFEQVVNELFRD--GVNWGRI---------VAFFSFGGALC----
A0A2I3LFM0_MCL1-02      LGKRPAVLPLLE---------LVGESGNSPSTD-----------------
A0A2I3LFM0_MCL1-01      LGKRPAVLPLLE---------LVGESGNSPSTD-----------------
A0A096NX09_BCL2L2-      GNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTI
A0A096NX09_BCL2L2-      GNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTI
A0A096NX09_BCL2L2-      GNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTI
A0A096NM44_BCL2L10      GNRVELVALMAEAVLSDSPGPTWGRV---------VSLVTFAGTLLEREP
A0A096MPU7_BCL2-01      FTARGRFATVVEELFRD--GVNWGRI---------VAFFEFGGVMC----
A0A096NV05_BCL2L1-      GTAYQSFEQVVNELFRD--GVNWGRI---------VAFFSFGGALC----
A0A096NMX5_BCL2A1-      IDTARTLFNQVMEKEFEDGIINWGRI---------VTIFAFEGILIKKL-
A0A096NMX5_BCL2A1-      IDTARTLFNQVMEKEFEDGIINWGRI---------VTIFAFEGILIKKL-
A0A096NX09_BCL2L2-      GSAQQR-FTQVSDELFQGG-PNWGRL---------VAFFVFGAALCAES-
A0A2I3LFM0_MCL1-03      EDDVKS-LSRVMVHVFSDGVTNWGRI---------VTLISFGAFVAKHL-
                                               *                          

A0A096NV05_BCL2L1-      --------------VESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGG
A0A2I3LFM0_MCL1-02      -----GSLPSTPPPAEEEEDELYRQSLEIISWYLREQATGAKDTKPMGRS
A0A2I3LFM0_MCL1-01      -----GSLPSTPPPAEEEEDELYRQSLEIISWYLREQATGAKDTKPMGRS
A0A096NX09_BCL2L2-      LCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPG
A0A096NX09_BCL2L2-      LCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPG
A0A096NX09_BCL2L2-      LCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPG
A0A096NM44_BCL2L10      LVTAWWKKRSFQPRLKEQEGDVARDCQRLVALLSSRLAGQHRAWLQAQGG
A0A096MPU7_BCL2-01      --------------VESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGG
A0A096NV05_BCL2L1-      --------------VESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGG
A0A096NMX5_BCL2A1-      --------------LRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGG
A0A096NMX5_BCL2A1-      --------------LRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGG
A0A096NX09_BCL2L2-      --------------VNKEMEPLVGQVQE---WMVAYLETRLADWIHSSGG
A0A2I3LFM0_MCL1-03      --------------KTINQESCIEPLAE---SITDVLVRTKRDWLVKQRG
                                                                         .

A0A096NV05_BCL2L1-      WDT-FVELYGNNAAAESRKG------------------------------
A0A2I3LFM0_MCL1-02      GAT-SRKALETLRRVGDGVQRNHETA--FQGMLRKLDIKNEDDVKSLSRV
A0A2I3LFM0_MCL1-01      GAT-SRKALETLRRVGDGVQRNHETA--FQGWVCGV--------------
A0A096NX09_BCL2L2-      IST-TDRGFPRARYRARTTNYNSSRSRFYSGFNSRP--------------
A0A096NX09_BCL2L2-      IST-TDRGFPRARYRARTTNYNSSRSRFYSGFNSRP--------------
A0A096NX09_BCL2L2-      IST-TDRGFPRARYRARTTNYNSSRSRFYSGFNSRP--------------
A0A096NM44_BCL2L10      WVS-TRRTPGRGAGRASGK-RPRGRHGWLLSLLQEP--------------
A0A096MPU7_BCL2-01      WDA-FVELYGPSM-------RPLFDFSWL---------------------
A0A096NV05_BCL2L1-      WDT-FVELYGNNAAAESRKGQERFN-------------------------
A0A096NMX5_BCL2A1-      WENGFVKKFEP----------KSG--------------------------
A0A096NMX5_BCL2A1-      WGK-----------------------------------------------
A0A096NX09_BCL2L2-      WAE-FTALYGDGALEEARRLREGN--------------------------
A0A2I3LFM0_MCL1-03      WDG-FVEFFHVEDL-------EGG--------------------------
                                                                          

A0A096NV05_BCL2L1-      ---------------------------------QERFNRWFLTGMTVAGV
A0A2I3LFM0_MCL1-02      MVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLV
A0A2I3LFM0_MCL1-01      ---LPCRGPRRW---------------------HQKCAAGFCRCCWS---
A0A096NX09_BCL2L2-      ---------------------------------RGRVYRGRARA------
A0A096NX09_BCL2L2-      ---------------------------------RGRVYRGRARA------
A0A096NX09_BCL2L2-      ---------------------------------RGRVYRGRARA------
A0A096NM44_BCL2L10      ---------------LSAGFLEKTADPGFPGMLVSNSLRLSLDTIIMSFN
A0A096MPU7_BCL2-01      ------------------------------------SLKTLLSLALVGAC
A0A096NV05_BCL2L1-      --------------------------------------RWFLTGMTVAGV
A0A096NMX5_BCL2A1-      ---------------------------------WMTFLEVTGKICEMLSL
A0A096NMX5_BCL2A1-      ---------------------------------WHNHMPM---LVESVAH
A0A096NX09_BCL2L2-      ---------------------------------WASVRTVLTGAVALGAL
A0A2I3LFM0_MCL1-03      ---------------------------------IRNVLLAFAGVAGVGA-
                                                                          

A0A096NV05_BCL2L1-      VLLGSLFSRK----------------------------------------
A0A2I3LFM0_MCL1-02      RTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A2I3LFM0_MCL1-01      ---RSWF---------------------------------GISNKIALL-
A0A096NX09_BCL2L2-      ---TSWYSPY----------------------------------------
A0A096NX09_BCL2L2-      ---TSWYSPY----------------------------------------
A0A096NX09_BCL2L2-      ---TSWYSPY----------------------------------------
A0A096NM44_BCL2L10      IFNPLLPAQL----------------------------------------
A0A096MPU7_BCL2-01      ITLGAYLGHK----------------------------------------
A0A096NV05_BCL2L1-      VLLGSLFSRK----------------------------------------
A0A096NMX5_BCL2A1-      LKQYC---------------------------------------------
A0A096NMX5_BCL2A1-      KKKKMAL-------------------------------------------
A0A096NX09_BCL2L2-      VTVGAFFASK----------------------------------------
A0A2I3LFM0_MCL1-03      ---GLAYLIR----------------------------------------
                                                                          

A0A096NV05_BCL2L1-      -
A0A2I3LFM0_MCL1-02      R
A0A2I3LFM0_MCL1-01      -
A0A096NX09_BCL2L2-      -
A0A096NX09_BCL2L2-      -
A0A096NX09_BCL2L2-      -
A0A096NM44_BCL2L10      -
A0A096MPU7_BCL2-01      -
A0A096NV05_BCL2L1-      -
A0A096NMX5_BCL2A1-      -
A0A096NMX5_BCL2A1-      -
A0A096NX09_BCL2L2-      -
A0A2I3LFM0_MCL1-03      -
                         

© 1998-2020Legal notice